Paralemmin Antibody

Images

 
Western Blot: Paralemmin Antibody [NBP1-87770] - Analysis in control (vector only transfected HEK293T lysate) and PALM over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: Paralemmin Antibody [NBP1-87770] - Staining of human cell line HEK 293 shows localization to nucleus & plasma membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Paralemmin Antibody [NBP1-87770] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Paralemmin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TKKVLGLQDTITAELVVIEDAAEPKEPAPPNGSAAEPPTEAASREENQAGPEATTSDPQDLDMKKHRCKCCSIM
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PALM
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Paralemmin Protein (NBP1-87770PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Paralemmin Antibody

  • KIAA0270
  • paralemmin

Background

Paralemmin encodes a member of the paralemmin protein family. The product of this gene is a prenylated and palmitoylated phosphoprotein that associates with the cytoplasmic face of plasma membranes and is implicated in plasma membrane dynamics in neurons and other cell types. Several alternatively spliced transcript variants have been identified, but the full-length nature of only two transcript variants has been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88481
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00114299-M09
Species: Hu, Rt
Applications: ELISA, WB
664-LI/CF
Species: Hu
Applications: BA
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP3-05061
Species: Hu, Mu
Applications: ICC/IF, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP3-05584
Species: Mu, Rt
Applications: WB
NBP3-13106
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
M5000
Species: Mu
Applications: ELISA
308-FK/CF
Species: Hu
Applications: BA
AF2009
Species: Hu
Applications: ICC, IHC
NBP2-15930
Species: Hu
Applications: ICC/IF, WB
NB110-68281
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF (-), Simple Western, WB
H00347527-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP3-15638
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NBP1-85563
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-47659
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-86616
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-58327
Species: Hu, Mu
Applications: ICC/IF, WB

Publications for Paralemmin Antibody (NBP1-87770) (0)

There are no publications for Paralemmin Antibody (NBP1-87770).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Paralemmin Antibody (NBP1-87770) (0)

There are no reviews for Paralemmin Antibody (NBP1-87770). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Paralemmin Antibody (NBP1-87770) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Paralemmin Products

Bioinformatics Tool for Paralemmin Antibody (NBP1-87770)

Discover related pathways, diseases and genes to Paralemmin Antibody (NBP1-87770). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Paralemmin Antibody (NBP1-87770)

Discover more about diseases related to Paralemmin Antibody (NBP1-87770).
 

Pathways for Paralemmin Antibody (NBP1-87770)

View related products by pathway.

PTMs for Paralemmin Antibody (NBP1-87770)

Learn more about PTMs related to Paralemmin Antibody (NBP1-87770).
 

Research Areas for Paralemmin Antibody (NBP1-87770)

Find related products by research area.

Blogs on Paralemmin

There are no specific blogs for Paralemmin, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Paralemmin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PALM