Home » Paralemmin » Paralemmin Antibodies » Paralemmin Antibody

Paralemmin Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: Paralemmin Antibody [NBP1-87770] - Analysis in control (vector only transfected HEK293T lysate) and PALM over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Western Blot: Paralemmin Antibody [NBP1-87770] - Analysis in control (vector only transfected HEK293T lysate) and PALM over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: Paralemmin Antibody [NBP1-87770] - Staining of human cell line HEK 293 shows localization to nucleus & plasma membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Paralemmin Antibody [NBP1-87770] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Paralemmin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TKKVLGLQDTITAELVVIEDAAEPKEPAPPNGSAAEPPTEAASREENQAGPEATTSDPQDLDMKKHRCKCCSIM
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PALM
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Paralemmin Protein (NBP1-87770PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Paralemmin Antibody

  • KIAA0270
  • paralemmin

Background

Paralemmin encodes a member of the paralemmin protein family. The product of this gene is a prenylated and palmitoylated phosphoprotein that associates with the cytoplasmic face of plasma membranes and is implicated in plasma membrane dynamics in neurons and other cell types. Several alternatively spliced transcript variants have been identified, but the full-length nature of only two transcript variants has been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PALMD Antibody
NBP1-88481
Immunohistochemistry-Paraffin: PALMD Antibody [NBP1-88481] - Staining of human placenta shows strong cytoplasmic positivity in decidual cells.
Immunohistochemistry-Paraffin: PALMD Antibody [NBP1-88481] - Staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: PALMD Antibody [NBP1-88481] - Staining of human liver shows moderate membranous positivity in hepatocytes.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
PALM2 Antibody
(1A8)
H00114299-M09
ELISA: PALM2 Antibody (1A8) [H00114299-M09] - Detection limit for recombinant GST tagged PALM2 is approximately 0.03ng/ml as a capture antibody.
Western Blot: PALM2 Antibody (1A8) [H00114299-M09] - Analysis of PALM2 expression in PC-12 (Cat # L012V1).
Western Blot: PALM2 Antibody (1A8) [H00114299-M09] - Analysis of PALM2 expression in transfected 293T cell line by PALM2 monoclonal antibody (M09), clone 1A8. Lane 1: PALM2 transfected lysatE (42.2 KDa). Lane 2: Non-transfected lysate.
Species: Hu, Rt
Applications: ELISA, WB
LIGHT/TNFSF14
[Unconjugated]
664-LI/CF
1 µg/lane of Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a band at 25 kDa.
Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) stimulates cell proliferation in HUVEC human umbilical vein endothelial cells. The ED50 is 1-4 ng/mL.
(18 Publications)
Species: Hu
Applications: BA
Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot: Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) [NB100-56603] - Analysis using Azide Free version of NB100-56603. LNCaP cells (passage number 38) were serum-starved for 2 days. After serum starvation, cells were (A) left untreated, (B) treated with 100 ng/ml IGF-1 for 4h, or (C) incubated with 20 um LY294002 for 30 mi
(14 Publications)
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
MID1 Antibody
NBP3-05061
Immunocytochemistry/Immunofluorescence: MID1 Antibody [NBP3-05061] - Analysis of MCF-7 cells using MID1 antibody . Blue: DAPI for nuclear staining.
Western Blot: MID1 Antibody [NBP3-05061] - analysis of extracts of HeLa cells, using MID1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 60s.
Species: Hu, Mu
Applications: ICC/IF, WB
Catalase Antibody
[Unconjugated]
AF3398
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, Raji human Burkitt's lymphoma cell line, HeLa human cervical epithelial carcinoma cell line, NIH‑3T3 mouse embryonic fibroblast cell line, A20 mouse B cell lymphoma cell line, andRat‑2 rat embryonic fibroblast cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti‑Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Catalase at approximately 64 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 2. 
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line and Raji human Burkitt's lymphoma cell line, loaded at 0.2 mg/mL. A specific band was detected for Catalase at approximately 62 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and Catalase knockout HeLa cell line (KO). PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Catalase at approximately 64 kDa (as indicated) in the parental HeLa cell line, but is not detectable in knockout HeLa cell line. GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(3 Reviews)
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
PRB4 Antibody
NBP3-05584
Western Blot: PRB4 Antibody [NBP3-05584] - Western blot analysis of extracts of various cell lines, using PRB4 antibody (NBP3-05584) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
Species: Mu, Rt
Applications: WB
Huntingtin Antibody
NBP3-13106
Western Blot: Huntingtin Antibody [NBP3-13106] - Various whole cell extracts (30 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with Huntingtin antibody (NBP3-13106) diluted at 1:1000.
Immunohistochemistry-Paraffin: Huntingtin Antibody [NBP3-13106] - Huntingtin antibody detects Huntingtin protein at cytoplasm in rat brain by immunohistochemical analysis. Sample: Paraffin-embedded rat brain. Huntingtin antibody (NBP3-13106) diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
Immunocytochemistry/Immunofluorescence: Huntingtin Antibody [NBP3-13106] - Huntingtin antibody detects Huntingtin protein at cytoplasm by immunofluorescent analysis. Sample: SK-N-SH cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Huntingtin protein stained by Huntingtin antibody (NBP3-13106) diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar = 10 um.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
IL-5 [HRP]
M5000
(86 Publications)
Species: Mu
Applications: ELISA
Flt-3 Ligand/FLT3L
[Unconjugated]
308-FK/CF
1 µg/lane of Recombinant Human Flt-3 Ligand/FLT3L was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing major bands at 22‑26 kDa. The multiple bands are due to variable glycosylation of the protein.
Recombinant Human Flt-3 Ligand/FLT3L (Catalog # 308-FK/CF) stimulates cell proliferation in the BaF3 mouse pro-B cell line transfected with mouse Flt-3. The ED50 for this effect is 0.2-1 ng/mL.
(57 Publications)
Species: Hu
Applications: BA
CD55/DAF Antibody
[Unconjugated]
AF2009
CD55/DAF was detected in immersion fixed paraffin-embedded sections of human colon cancer tissue using 15 µg/mL Goat Anti-Human CD55/DAF Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2009) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
CD55/DAF was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line (left panel, positive staining) and MOLT-4 human acute lymphoblastic leukemia cell line (right panel, negative staining) using Goat Anti-Human CD55/DAF Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2009) at 0.5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to plasma membrane and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(5 Publications)
Species: Hu
Applications: ICC, IHC
CNOT8 Antibody
NBP2-15930
Western Blot: CNOT8 Antibody [NBP2-15930] - Sample (30 ug of whole cell lysate) A: SK-N-SH 12% SDS PAGE gel, diluted at 1:500.
Immunocytochemistry/Immunofluorescence: CNOT8 Antibody [NBP2-15930] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: CNOT8 protein stained by CNOT8 antibody diluted at 1:200. Blue: Hoechst 33342 staining.
(1 Publication)
Species: Hu
Applications: ICC/IF, WB
TRF-1 Antibody
(57-6)
NB110-68281
Flow Cytometry: TRF-1 Antibody (57-6) [NB110-68281] - An intracellular stain was performed on HeLa with NB110-68281 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by mouse F(ab)2 IgG (H+L) APC-conjugated secondary antibody (F0101B, R&D Systems).
Western Blot: TRF-1 Antibody (57-6) [NB110-68281] - MicroRNA-214-3p (miR-214) mimic in rat vascular smooth muscle cells (A7r5) suppressed angiogenesis and proliferation but promoted senescence. Representative western blots depicting TERF1, TERF2, and quaking expression in mimic NC or miR-214 mimic transfected cells. Image collected and cropped by CiteAb from the following publication (https://molmed.biomedcentral.com/articles/10.1186/s10020-020-00167-1), licensed under a CC-BY licence.
Simple Western: TRF-1 Antibody (57-6) [NB110-68281] - Image shows a specific band for TRF1 in 0.5 mg/mL of HeLa lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
(4 Publications)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF (-), Simple Western, WB
Recombinant Human
ARSH GST (N-Term) Pro ...
H00347527-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, WB
GRB2 Antibody
(9K6H0)
NBP3-15638
Immunohistochemistry-Paraffin: GRB2 Antibody (9K6H0) [NBP3-15638] - Immunohistochemistry of paraffin-embedded rat spleen using GRB2 Rabbit mAb (NBP3-15638) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: GRB2 Antibody (9K6H0) [NBP3-15638] - Immunohistochemistry of paraffin-embedded human lung cancer using GRB2 Rabbit mAb (NBP3-15638) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: GRB2 Antibody (9K6H0) [NBP3-15638] - Immunohistochemistry of paraffin-embedded mouse spleen using GRB2 Rabbit mAb (NBP3-15638) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
PrPC Antibody
NB100-56605
Western Blot: PrPC Antibody [NB100-56605] - Analysis of BSE in (A) recombinant fusion protein containing amino acids 162-170 and (B) fusion partner without these amino acids, using this antibody at 5 ug/ml.
Species: Av, Bv, Sh
Applications: WB
PPT1 Antibody
NBP1-85563
Western Blot: PPT1 Antibody [NBP1-85563] - Analysis in human cell line THP-1.
Immunohistochemistry-Paraffin: PPT1 Antibody [NBP1-85563] - Staining of human cerebral cortex shows very strong granular positivity in cytoplasm in neurons.
Immunohistochemistry-Paraffin: PPT1 Antibody [NBP1-85563] - Staining of human lung shows very strong granular positivity in cytoplasm in macrophages.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Pancreatic Amylase
Alpha Antibody (OTI6D ...
NBP1-47659
Immunohistochemistry-Paraffin: Pancreatic Amylase Alpha Antibody (6D4) [NBP1-47659] - Pancreatic Amylase Alpha Antibody (6D4) Staining of paraffin-embedded Adenocarcinoma of breast using anti-Pancreatic Amylase mouse monoclonal antibody.
Immunohistochemistry-Paraffin: Pancreatic Amylase Alpha Antibody (6D4) [NBP1-47659] - Pancreatic Amylase Alpha Antibody (6D4) Staining of paraffin-embedded Adenocarcinoma of ovary using anti-Pancreatic Amylase mouse monoclonal antibody.
Immunohistochemistry-Paraffin: Pancreatic Amylase Alpha Antibody (6D4) [NBP1-47659] - Pancreatic Amylase Alpha Antibody (6D4) Staining of paraffin-embedded Carcinoma of kidney using anti-Pancreatic Amylase mouse monoclonal antibody.
(1 Review)
Species: Hu
Applications: IHC, IHC-P, WB
CRAT Antibody
NBP1-86616
Western Blot: CRAT Antibody [NBP1-86616] - Analysis in human cell line TD47D.
Western Blot: CRAT Antibody [NBP1-86616] - Analysis using Anti-CRAT antibody NBP1-86616 (A) shows similar pattern to independent antibody NBP1-86615 (B).
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86616] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
ABCB6 Antibody
NBP2-58327
Western Blot: ABCB6 Antibody [NBP2-58327] - Analysis in human cell lines Caco-2 and A-431. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PARP1.
Immunocytochemistry/Immunofluorescence: ABCB6 Antibody [NBP2-58327] - Staining of human cell line U-251 MG shows localization to nucleoplasm & the Golgi apparatus. Antibody staining is shown in green.
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, WB

Publications for Paralemmin Antibody (NBP1-87770) (0)

There are no publications for Paralemmin Antibody (NBP1-87770).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Paralemmin Antibody (NBP1-87770) (0)

There are no reviews for Paralemmin Antibody (NBP1-87770). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Paralemmin Antibody (NBP1-87770) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Paralemmin Products

Bioinformatics Tool for Paralemmin Antibody (NBP1-87770)

Discover related pathways, diseases and genes to Paralemmin Antibody (NBP1-87770). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Paralemmin Antibody (NBP1-87770)

Discover more about diseases related to Paralemmin Antibody (NBP1-87770).
 

Pathways for Paralemmin Antibody (NBP1-87770)

View related products by pathway.

PTMs for Paralemmin Antibody (NBP1-87770)

Learn more about PTMs related to Paralemmin Antibody (NBP1-87770).
 

Research Areas for Paralemmin Antibody (NBP1-87770)

Find related products by research area.

Blogs on Paralemmin

There are no specific blogs for Paralemmin, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Paralemmin Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol PALM