Paralemmin Antibody

Images

 
Western Blot: Paralemmin Antibody [NBP1-87770] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunocytochemistry/ Immunofluorescence: Paralemmin Antibody [NBP1-87770] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleus & plasma membrane.
Immunohistochemistry-Paraffin: Paralemmin Antibody [NBP1-87770] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.
Immunocytochemistry: Paralemmin Antibody [NBP1-87770] - Staining of human cell line U-2 OS shows positivity in vesicles.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, ICC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Paralemmin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TKKVLGLQDTITAELVVIEDAAEPKEPAPPNGSAAEPPTEAASREENQAGPEATTSDPQDLDMKKHRCKCCSIM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PALM
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
  • Immunocytochemistry
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Paralemmin Protein (NBP1-87770PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Paralemmin Antibody

  • KIAA0270
  • paralemmin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88481
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00114299-M09
Species: Hu, Rt
Applications: WB, ELISA
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
H00005545-R02
Species: Hu
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
AF2009
Species: Hu
Applications: WB, IHC
NBP2-15930
Species: Hu
Applications: WB, ICC/IF
NB110-68281
Species: Hu, Mu, Rt, Mk
Applications: ICC/IF (-), WB, Simple Western, ELISA, Flow
H00347527-B01P
Species: Hu
Applications: WB, ELISA
MAB38461
Species: Hu
Applications: WB, IHC
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NBP2-45388
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87770
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC

Publications for Paralemmin Antibody (NBP1-87770) (0)

There are no publications for Paralemmin Antibody (NBP1-87770).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Paralemmin Antibody (NBP1-87770) (0)

There are no reviews for Paralemmin Antibody (NBP1-87770). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Paralemmin Antibody (NBP1-87770) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Paralemmin Products

Bioinformatics Tool for Paralemmin Antibody (NBP1-87770)

Discover related pathways, diseases and genes to Paralemmin Antibody (NBP1-87770). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Paralemmin Antibody (NBP1-87770)

Discover more about diseases related to Paralemmin Antibody (NBP1-87770).
 

Pathways for Paralemmin Antibody (NBP1-87770)

View related products by pathway.

PTMs for Paralemmin Antibody (NBP1-87770)

Learn more about PTMs related to Paralemmin Antibody (NBP1-87770).

Blogs on Paralemmin

There are no specific blogs for Paralemmin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Paralemmin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PALM