MEF2C Antibody (CL0369)

Images

 
Western Blot: MEF2C Antibody (CL0369) [NBP2-30671] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate ...read more
Immunohistochemistry: MEF2C Antibody (CL0369) [NBP2-30671] - Staining of human pancreas shows absence of staining in the exocrine glandular cells (negative control).
Immunohistochemistry: MEF2C Antibody (CL0369) [NBP2-30671] - Staining of human cerebral cortex shows nuclear immunoreactivity in a subset of neurons.
Immunohistochemistry: MEF2C Antibody (CL0369) [NBP2-30671] - Staining of human skeletal muscle shows distinct nuclear positivity in the muscle fibers.
Immunohistochemistry: MEF2C Antibody (CL0369) [NBP2-30671] - Staining of human cerebellum shows nuclear immunoreactivity in Purkinje cells, as well as in neuronal cells in the granular and molecular layers.
Immunohistochemistry: MEF2C Antibody (CL0369) [NBP2-30671] - Staining of human tonsil shows strong nuclear immunoreactivity in the germinal center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clone
CL0369
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MEF2C Antibody (CL0369) Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PPNFEMPVSIPVSSHNSLVYSNPVSSLGNPNLLPLAHPSLQRNSMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKSPPPMNLGMNNRKPDLRVLIPPGSKNTMPSVNQRINN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
MEF2C
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500 - 1:1000
  • Immunohistochemistry 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for MEF2C Antibody (CL0369)

  • DEL5q14.3
  • MEF2C
  • myocyte enhancer factor 2C
  • myocyte-specific enhancer factor 2C
  • polypeptide C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004205-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-31558
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP2-16613
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2848
Species: Hu, Mu
Applications: WB, ICC
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85788
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-56341
Species: Hu
Applications: WB, ChIP, IP
NBP1-89655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22152
Species: Hu, Mu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-16613
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-93440
Species: Hu
Applications: IHC, IHC-P

Publications for MEF2C Antibody (NBP2-30671) (0)

There are no publications for MEF2C Antibody (NBP2-30671).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MEF2C Antibody (NBP2-30671) (0)

There are no reviews for MEF2C Antibody (NBP2-30671). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MEF2C Antibody (NBP2-30671) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MEF2C Products

Bioinformatics Tool for MEF2C Antibody (NBP2-30671)

Discover related pathways, diseases and genes to MEF2C Antibody (NBP2-30671). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MEF2C Antibody (NBP2-30671)

Discover more about diseases related to MEF2C Antibody (NBP2-30671).
 

Pathways for MEF2C Antibody (NBP2-30671)

View related products by pathway.

PTMs for MEF2C Antibody (NBP2-30671)

Learn more about PTMs related to MEF2C Antibody (NBP2-30671).
 

Research Areas for MEF2C Antibody (NBP2-30671)

Find related products by research area.

Blogs on MEF2C

There are no specific blogs for MEF2C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MEF2C Antibody (CL0369) and receive a gift card or discount.

Bioinformatics

Gene Symbol MEF2C
Entrez
Uniprot