MED12 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: MED12 Antibody [NBP1-86669] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: MED12 Antibody [NBP1-86669] - Staining in human placenta and pancreas tissues using anti-MED12 antibody. Corresponding MED12 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: MED12 Antibody [NBP1-86669] - Staining of human cerebral cortex, colon, spleen and testis using Anti-MED12 antibody NBP1-86669 (A) shows similar protein distribution across tissues to independent antibody NBP1-86670 (B).

Immunohistochemistry-Paraffin: MED12 Antibody [NBP1-86669] - Staining of human colon.

Immunohistochemistry-Paraffin: MED12 Antibody [NBP1-86669] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: MED12 Antibody [NBP1-86669] - Staining of human placenta shows high expression.

Immunohistochemistry-Paraffin: MED12 Antibody [NBP1-86669] - Staining of human spleen.

Immunohistochemistry-Paraffin: MED12 Antibody [NBP1-86669] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: MED12 Antibody [NBP1-86669] - Staining of human testis.

Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-MED12 antibody. Remaining relative intensity is presented.

ChIP-Exo-Seq composite graph for Anti-MED12 (NBP1-86669) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, ChIP, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MED12 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MED12 Antibody - BSA Free (NBP1-86669) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LPTTMTGVMGLEPSSYKTSVYRQQQPAVPQGQRLRQQLQAKIQSQGMLGQSSVHQMTPSSSYGLQTSQGYTPYVSHVGLQQHTGPAGTMVPPSYSSQPYQSTHPSTNPTLVDPTRHLQQRPSGYVHQQAPTYGHGLTS
• Predicted Species: Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MED12
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MED12 Protein (NBP1-86669PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MED12 Antibody - BSA Free

• ARC240
• CAG repeat protein 45
• CAGH45trinucleotide repeat containing 11 (THR-associated protein, 230kDa subunit)
• HOPAFGS1
• KIAA0192FG syndrome 1
• mediator complex subunit 12OPA-containing protein
• OKSsubunit 12 homolog
• thyroid hormone receptor-associated protein, 230 kDa subunit
• Trap230
• TRAP230mediator of RNA polymerase II transcription, subunit 12 homolog (S. cerevisiae)
• trinucleotide repeat containing 11 (THR-associated protein, 230 kDa subunit)
• Trinucleotide repeat-containing gene 11 protein

Background

The initiation of transcription is controlled in part by a large protein assembly known as the preinitiation complex. A component of this preinitiation complex is a 1.2 MDa protein aggregate called Mediator. This Mediator component binds with a CDK8 subcomplex which contains the protein encoded by this gene, mediator complex subunit 12 (MED12), along with MED13, CDK8 kinase, and cyclin C. The CDK8 subcomplex modulates Mediator-polymerase II interactions and thereby regulates transcription initiation and reinitation rates. The MED12 protein is essential for activating CDK8 kinase. Defects in this gene cause X-linked Opitz-Kaveggia syndrome, also known as FG syndrome, and Lujan-Fryns syndrome. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MED12