ME2 Antibody

Images

 
Independent Antibodies: Western Blot: ME2 Antibody [NBP1-82434] - Analysis using Anti-ME2 antibody NBP1-82434 (A) shows similar pattern to independent antibody NBP1-89559 (B).
Immunocytochemistry/ Immunofluorescence: ME2 Antibody [NBP1-82434] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: ME2 Antibody [NBP1-82434] - Staining of human cerebral cortex.
Western Blot: ME2 Antibody [NBP1-82434] - Analysis in human cell line A-431.
Orthogonal Strategies: Western Blot: ME2 Antibody [NBP1-82434] - Analysis in human cell lines A-431 and MCF-7. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Immunohistochemistry-Paraffin: ME2 Antibody [NBP1-82434] - Staining of human colon shows strong cytoplasmic positivity in granular pattern in glandular cells.
Immunohistochemistry-Paraffin: ME2 Antibody [NBP1-82434] - Staining of human duodenum shows high expression.
Immunohistochemistry-Paraffin: ME2 Antibody [NBP1-82434] - Staining of human liver shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: ME2 Antibody [NBP1-82434] - Staining in human duodenum and liver tissues using anti-ME2 antibody. Corresponding ME2 RNA-seq data are presented for the same ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: ME2 Antibody [NBP1-82434] - Staining of human cerebral cortex, colon, lymph node and testis using Anti-ME2 antibody NBP1-82434 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: ME2 Antibody [NBP1-82434] - Staining of human lymph node.
Immunohistochemistry-Paraffin: ME2 Antibody [NBP1-82434] - Staining of human colon.
Immunohistochemistry-Paraffin: ME2 Antibody [NBP1-82434] - Staining of human testis.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ME2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWPESASSPPV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ME2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ME2 Protein (NBP1-82434PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ME2 Antibody

  • EC 1.1.1
  • EC 1.1.1.38
  • malate dehydrogenase
  • Malic enzyme 2
  • malic enzyme 2, NAD(+)-dependent, mitochondrial
  • NAD-dependent malic enzyme, mitochondrial
  • NAD-ME
  • ODS1
  • pyruvic-malic carboxylase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86036
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB100-236
Species: Hu, Mu
Applications: IB, IHC, IHC-Fr, IP, WB
NBP2-45880
Species: Hu, Mu, Rt
Applications: IF, IHC, IHC-P, WB
NBP2-02541
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-47754
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB919
Species: Hu
Applications: AP, IHC, IP, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-01109
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-75610
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-80533
Species: Hu, Mu
Applications: WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-75609
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-82847
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-32398
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP1-89515
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-02164
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP1-82434
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ME2 Antibody (NBP1-82434) (0)

There are no publications for ME2 Antibody (NBP1-82434).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ME2 Antibody (NBP1-82434) (0)

There are no reviews for ME2 Antibody (NBP1-82434). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ME2 Antibody (NBP1-82434) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ME2 Products

Array NBP1-82434

Bioinformatics Tool for ME2 Antibody (NBP1-82434)

Discover related pathways, diseases and genes to ME2 Antibody (NBP1-82434). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ME2 Antibody (NBP1-82434)

Discover more about diseases related to ME2 Antibody (NBP1-82434).
 

Pathways for ME2 Antibody (NBP1-82434)

View related products by pathway.

PTMs for ME2 Antibody (NBP1-82434)

Learn more about PTMs related to ME2 Antibody (NBP1-82434).

Blogs on ME2

There are no specific blogs for ME2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ME2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ME2