We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

MCT2 Recombinant Protein Antigen

Images

 
There are currently no images for MCT2 Protein (NBP1-87846PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MCT2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC16A7.

Source: E. coli

Amino Acid Sequence: GPNQTTSKSKNKTGKTEDDSSPKKIKTKKSTWEKVNKYLDFS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLC16A7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87846.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MCT2 Recombinant Protein Antigen

  • MCT 2
  • MCT2
  • MCT2solute carrier family 16 (monocarboxylic acid transporters), member 7
  • monocarboxylate transporter 2
  • SLC16A7
  • Solute carrier family 16 member 7
  • solute carrier family 16, member 7 (monocarboxylic acid transporter 2)

Background

Lactic acid and pyruvate transport across plasma membranes is catalyzed by members of the proton-linked monocarboxylate transporter (MCT) family, which has been designated solute carrier family 16. Each MCT appears to have slightly different substrate and inhibitor specificities and transport kinetics, which are related to the metabolic requirements of the tissues in which it is found. MCT2 is a high affinity transporter that catalyzes the rapid transport of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate across the plasma membrane.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59656
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
NBP2-03626
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
MAB4099
Species: Hu
Applications: ELISA, IP, WB
NBP1-81251
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western
NBP2-13315
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF3998
Species: Hu
Applications: WB
NBP1-83936
Species: Hu
Applications: IHC,  IHC-P, WB
NB110-39113
Species: Hu, Mu, Rb, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, Simple Western, WB
AF972
Species: Hu
Applications: ELISA, IHC, KO, Simple Western, WB
NBP1-89762
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-59885
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-49533
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, KD, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP1-47778
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-24689
Species: Hu, Mu
Applications: WB
NBP2-57308
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
MAB8398
Species: Hu
Applications: CyTOF-ready, Flow
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
H00005706-M02
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, WB
NBP1-87846PEP
Species: Hu
Applications: AC

Publications for MCT2 Protein (NBP1-87846PEP) (0)

There are no publications for MCT2 Protein (NBP1-87846PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MCT2 Protein (NBP1-87846PEP) (0)

There are no reviews for MCT2 Protein (NBP1-87846PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MCT2 Protein (NBP1-87846PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MCT2 Products

Research Areas for MCT2 Protein (NBP1-87846PEP)

Find related products by research area.

Blogs on MCT2

There are no specific blogs for MCT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GFAP Antibody
NB300-141

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MCT2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC16A7