MCM9 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MCM9 Antibody [NBP1-86740] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: MCM9 Antibody [NBP1-86740] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MCM9 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SPPPERKNRGERGPSSPPTTTAPMRVSKRKSFQLRGSTEKLIVSKESLFTLPELGDEAFDCDWD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MCM9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MCM9 Protein (NBP1-86740PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MCM9 Antibody

  • C6orf61
  • chromosome 6 open reading frame 61
  • dJ329L24.1
  • dJ329L24.3
  • DNA replication licensing factor MCM9
  • FLJ13942
  • FLJ20170
  • FLJ56845
  • hMCM9
  • MCMDC1
  • MGC35304
  • minichromosome maintenance complex component 9
  • Mini-chromosome maintenance deficient 9
  • minichromosome maintenance deficient domain containing 1
  • Mini-chromosome maintenance deficient domain-containing protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-325
Species: Hu
Applications: WB, ChIP, IP
NBP2-46403
Species: Hu
Applications: IHC
NBP1-87423
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00051053-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-253
Species: Hu
Applications: WB, IP
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
H00246243-M01
Species: Hu, Rt
Applications: WB, ELISA
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00009837-B02P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-33825
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
MAB2476
Species: Hu
Applications: WB, IHC
NBP1-87814
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00010714-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-2567
Species: Hu
Applications: WB, IHC-P, IP
NBP1-82139
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-16659
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00057804-M01A
Species: Hu
Applications: WB, ELISA
NBP2-13541
Species: Hu, Mu
Applications: Simple Western, IHC, IHC-P

Publications for MCM9 Antibody (NBP1-86740) (0)

There are no publications for MCM9 Antibody (NBP1-86740).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MCM9 Antibody (NBP1-86740) (0)

There are no reviews for MCM9 Antibody (NBP1-86740). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MCM9 Antibody (NBP1-86740) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MCM9 Products

Bioinformatics Tool for MCM9 Antibody (NBP1-86740)

Discover related pathways, diseases and genes to MCM9 Antibody (NBP1-86740). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MCM9 Antibody (NBP1-86740)

Discover more about diseases related to MCM9 Antibody (NBP1-86740).
 

Pathways for MCM9 Antibody (NBP1-86740)

View related products by pathway.

Blogs on MCM9

There are no specific blogs for MCM9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MCM9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MCM9