MCM9 Antibody


Immunocytochemistry/ Immunofluorescence: MCM9 Antibody [NBP1-86740] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: MCM9 Antibody [NBP1-86740] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

MCM9 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: SPPPERKNRGERGPSSPPTTTAPMRVSKRKSFQLRGSTEKLIVSKESLFTLPELGDEAFDCDWD
Specificity of human MCM9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MCM9 Protein (NBP1-86740PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for MCM9 Antibody

  • C6orf61
  • chromosome 6 open reading frame 61
  • dJ329L24.1
  • dJ329L24.3
  • DNA replication licensing factor MCM9
  • FLJ13942
  • FLJ20170
  • FLJ56845
  • hMCM9
  • MCMDC1
  • MGC35304
  • minichromosome maintenance complex component 9
  • Mini-chromosome maintenance deficient 9
  • minichromosome maintenance deficient domain containing 1
  • Mini-chromosome maintenance deficient domain-containing protein 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ChIP, IP
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
Species: Hu, Rt
Applications: WB, ELISA
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
Species: Hu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu
Applications: Simple Western, IHC, IHC-P

Publications for MCM9 Antibody (NBP1-86740) (0)

There are no publications for MCM9 Antibody (NBP1-86740).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MCM9 Antibody (NBP1-86740) (0)

There are no reviews for MCM9 Antibody (NBP1-86740). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MCM9 Antibody (NBP1-86740) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MCM9 Products

Bioinformatics Tool for MCM9 Antibody (NBP1-86740)

Discover related pathways, diseases and genes to MCM9 Antibody (NBP1-86740). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MCM9 Antibody (NBP1-86740)

Discover more about diseases related to MCM9 Antibody (NBP1-86740).

Pathways for MCM9 Antibody (NBP1-86740)

View related products by pathway.

Blogs on MCM9

There are no specific blogs for MCM9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MCM9 Antibody and receive a gift card or discount.


Gene Symbol MCM9