RNase H1 Antibody (5D10)

Images

 
Western Blot: RNase H1 Antibody (5D10) [H00246243-M01] - RNASEH1 monoclonal antibody (M01), clone 5D10. Analysis of RNASEH1 expression in PC-12.
Western Blot: RNase H1 Antibody (5D10) [H00246243-M01] - RNASEH1 monoclonal antibody (M01), clone 5D10 Analysis of RNASEH1 expression in HeLa.
Western Blot: RNase H1 Antibody (5D10) [H00246243-M01] - Analysis of RNASEH1 expression in transfected 293T cell line by RNASEH1 monoclonal antibody (M01), clone 5D10.Lane 1: RNASEH1 transfected lysate(32.1 KDa).Lane 2: ...read more
ELISA: RNase H1 Antibody (5D10) [H00246243-M01] - Detection limit for recombinant GST tagged RNASEH1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA
Clone
5D10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RNase H1 Antibody (5D10) Summary

Immunogen
RNASEH1 (NP_002927, 189 a.a. ~ 286 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AACKAIEQAKTQNINKLVLYTDSMFTINGITNWVQGWKKNGWKTSAGKEVINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSED
Specificity
RNASEH1 - ribonuclease H1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RNASEH1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA 1:100-1:2000
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.
Publications
Read Publications using
H00246243-M01 in the following applications:

  • WB
    3 publications

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RNase H1 Antibody (5D10)

  • EC 3.1.26.4
  • H1RNA
  • Ribonuclease H type II
  • ribonuclease H1
  • RNase H1
  • RNH1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89165
Species: Hu
Applications: IHC, IHC-P
NBP2-59320
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NB100-150
Species: Hu, Mu
Applications: ChIP, ICC/IF, IP, WB
DAN00
Species: Hu
Applications: ELISA
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NBP1-87804
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-91872
Species: Hu
Applications: IHC, IHC-P
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB100-304
Species: Bt, Bv, Ca, Fi, Gt, Hu, Mu, Pm, Rt
Applications: ChIP, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ISH, KD, KO, WB
NB100-119
Species: Ba, Ch, Fi, Ha, Hu, Mu, Rb
Applications: ICC/IF, IHC-P, IP, In vitro, RIA, WB
NBP1-06274
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB
NBP1-90365
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PLA, WB
NB100-351
Species: Ha, Hu, Mu(-), Pm, Rt(-)
Applications: ELISA, IHC, IHC-P, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB

Publications for RNase H1 Antibody (H00246243-M01)(4)

Reviews for RNase H1 Antibody (H00246243-M01) (0)

There are no reviews for RNase H1 Antibody (H00246243-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RNase H1 Antibody (H00246243-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RNase H1 Products

Bioinformatics Tool for RNase H1 Antibody (H00246243-M01)

Discover related pathways, diseases and genes to RNase H1 Antibody (H00246243-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNase H1 Antibody (H00246243-M01)

Discover more about diseases related to RNase H1 Antibody (H00246243-M01).
 

Pathways for RNase H1 Antibody (H00246243-M01)

View related products by pathway.

PTMs for RNase H1 Antibody (H00246243-M01)

Learn more about PTMs related to RNase H1 Antibody (H00246243-M01).

Blogs on RNase H1

There are no specific blogs for RNase H1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNase H1 Antibody (5D10) and receive a gift card or discount.

Bioinformatics

Gene Symbol RNASEH1
Entrez
OMIM
Uniprot