ZDHHC2 Antibody


Immunohistochemistry-Paraffin: ZDHHC2 Antibody [NBP2-13541] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.
Simple Western: ZDHHC2 Antibody [NBP2-13541] - Simple Western lane view shows a specific band for ZDHHC2 in 0.2 mg/ml of Liver lysate. This experiment was performed under reducing conditions using the 12-230 kDa ...read more
Simple Western: ZDHHC2 Antibody [NBP2-13541] - Electropherogram image(s) of corresponding Simple Western lane view. ZDHHC2 antibody was used at 1:20 dilution on Liver lysate(s).

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications Simple Western, IHC, IHC-P

Order Details

ZDHHC2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: KEFHLSYAEKDLLEREPRGEAHQEVLRRAAKDLPIYTRTMSGAIRYCDRC QLI
Specificity of human, mouse ZDHHC2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (96%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Simple Western 1:20
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control Peptide
ZDHHC2 Protein (NBP2-13541PEP)
Read Publication using
NBP2-13541 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 26214373)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ZDHHC2 Antibody

  • DHHC2
  • DHHC-2
  • EC 2.3.1
  • EC 2.3.1.-
  • palmitoyltransferase ZDHHC2
  • ream
  • REC
  • Reduced expression associated with metastasis protein
  • Reduced expression in cancer protein
  • Zinc finger DHHC domain-containing protein 2
  • Zinc finger protein 372
  • zinc finger, DHHC domain containing 2
  • zinc finger, DHHC-type containing 2
  • ZNF372rec


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
Species: Hu, Dr
Applications: EM, PEP-ELISA
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
Species: Hu, Mu, Rt
Applications: Simple Western, IHC, IHC-P

Publications for ZDHHC2 Antibody (NBP2-13541)(1)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 2 applications: IHC, WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for ZDHHC2 Antibody (NBP2-13541) (0)

There are no reviews for ZDHHC2 Antibody (NBP2-13541). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ZDHHC2 Antibody (NBP2-13541) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ZDHHC2 Products

Bioinformatics Tool for ZDHHC2 Antibody (NBP2-13541)

Discover related pathways, diseases and genes to ZDHHC2 Antibody (NBP2-13541). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZDHHC2 Antibody (NBP2-13541)

Discover more about diseases related to ZDHHC2 Antibody (NBP2-13541).

Pathways for ZDHHC2 Antibody (NBP2-13541)

View related products by pathway.

PTMs for ZDHHC2 Antibody (NBP2-13541)

Learn more about PTMs related to ZDHHC2 Antibody (NBP2-13541).

Blogs on ZDHHC2

There are no specific blogs for ZDHHC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ZDHHC2 Antibody and receive a gift card or discount.


Gene Symbol ZDHHC2