Reactivity | Hu, Mu, RtSpecies Glossary |
Applications | WB, Simple Western, IHC, IHC-P |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KEFHLSYAEKDLLEREPRGEAHQEVLRRAAKDLPIYTRTMSGAIRYCDRC QLI |
Specificity | Specificity of human ZDHHC2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Predicted Species | Rat (96%). Backed by our 100% Guarantee. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | ZDHHC2 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. WB reactivity reported in (PMID: 26214373). |
||
Control Peptide |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Publication using NBP2-13541 | Applications | Species |
---|---|---|
Brichta L, Shin W, Jackson-Lewis V et al. Identification of neurodegenerative factors using translatome-regulatory network analysis Nat. Neurosci. 2015 Jul 27 [PMID: 26214373] (WB, IHC, Human, Mouse) | WB, IHC | Human, Mouse |
Secondary Antibodies |
Isotype Controls |
Diseases for ZDHHC2 Antibody (NBP2-13541)Discover more about diseases related to ZDHHC2 Antibody (NBP2-13541).
| Pathways for ZDHHC2 Antibody (NBP2-13541)View related products by pathway.
|
PTMs for ZDHHC2 Antibody (NBP2-13541)Learn more about PTMs related to ZDHHC2 Antibody (NBP2-13541).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | ZDHHC2 |