Mcl-1 Recombinant Protein Antigen

Images

 
There are currently no images for Mcl-1 Recombinant Protein Antigen (NBP2-52968PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Mcl-1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Mcl-1.

Source: E. coli

Amino Acid Sequence: DAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MCL1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52968. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Mcl-1 Recombinant Protein Antigen

  • BCL2L3
  • bcl2-L-3
  • BCL2L3MGC104264
  • Bcl-2-like protein 3
  • Bcl-2-related protein EAT/mcl1
  • EAT
  • induced myeloid leukemia cell differentiation protein Mcl-1
  • Mcl1
  • Mcl-1
  • mcl1/EAT
  • MCL1-ES
  • MCL1L
  • MCL1S
  • MGC1839
  • myeloid cell leukemia ES
  • myeloid cell leukemia sequence 1 (BCL2-related)
  • TM

Background

Mcl-1 (Myeloid cell leukemia-1) is Bcl-2-related and was identified as an early-induction gene that increased in expression during the differentiation of human myeloblastic leukemia cell ML-1, or exposure to different DNA damaging agents. The level of Mcl-1 is decreased in peripheral B lymphocytes undergoing apoptosis following treatment with apoptotic stimuli such as TGF-alpha 1 and forskolin. Expression of Mcl-1 is able to delay apoptosis induced by over-expression of c-myc in CHO 5AHSmyc cells. In hematopoietic FDC-P1 cells, Mcl-1 interacts with another Bcl-2-related protein, Bax, and prolongs cell viability after treatment with different apoptotic reagents.This monoclonal antibody detected a 37kd MCL1 in BCBL-1 cell lysate.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF800
Species: Hu, Mu
Applications: IP, Simple Western, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
AF820
Species: Hu, Mu
Applications: ICC, IHC, KO, Simple Western, WB
AF816
Species: Hu
Applications: ICC, IHC, WB
NBP1-76963
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, Simple Western, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NB600-1159
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF8221
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, Simple Western, WB
MAB1799
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
AF860
Species: Hu, Mu
Applications: IP, Simple Western, WB
375-TL
Species: Hu
Applications: BA
NB100-56599
Species: Hu, Mu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
M6000B
Species: Mu
Applications: ELISA
NBP2-52968PEP
Species: Hu
Applications: AC

Publications for Mcl-1 Recombinant Protein Antigen (NBP2-52968PEP) (0)

There are no publications for Mcl-1 Recombinant Protein Antigen (NBP2-52968PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Mcl-1 Recombinant Protein Antigen (NBP2-52968PEP) (0)

There are no reviews for Mcl-1 Recombinant Protein Antigen (NBP2-52968PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Mcl-1 Recombinant Protein Antigen (NBP2-52968PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Mcl-1 Products

Research Areas for Mcl-1 Recombinant Protein Antigen (NBP2-52968PEP)

Find related products by research area.

Blogs on Mcl-1.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Mcl-1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MCL1