MCF2L2 Antibody

Images

 
Immunohistochemistry: MCF2L2 Antibody [NBP1-90851] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MCF2L2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EMSTSKGSGAGSGPWIKNMERATTSKEDPASSTGGIKGCSSREFSSTDTFEDCEGAEDMEKESSALSLAGLFQSDDSHETCSSKSAFLERGESSQGE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MCF2L2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MCF2L2 Protein (NBP1-90851PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MCF2L2 Antibody

  • ARHGEF22
  • dbs-related Rho family guanine nucleotide exchange factor
  • MCF.2 cell line derived transforming sequence-like 2
  • MCF2-transforming sequence-like protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NB100-1617
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
H00009768-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-31413
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00058516-B02P
Species: Hu
Applications: WB, ELISA, ICC/IF
H00006124-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP1-47615
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P
MAB4077
Species: Hu
Applications: WB, IHC
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
MAB367
Species: Hu, Ca
Applications: WB, IHC, ICC
NB300-143
Species: Hu, Mu, Rt, Po, Ca, Ch, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-90851
Species: Hu
Applications: IHC, IHC-P

Publications for MCF2L2 Antibody (NBP1-90851) (0)

There are no publications for MCF2L2 Antibody (NBP1-90851).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MCF2L2 Antibody (NBP1-90851) (0)

There are no reviews for MCF2L2 Antibody (NBP1-90851). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MCF2L2 Antibody (NBP1-90851) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MCF2L2 Products

Bioinformatics Tool for MCF2L2 Antibody (NBP1-90851)

Discover related pathways, diseases and genes to MCF2L2 Antibody (NBP1-90851). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MCF2L2 Antibody (NBP1-90851)

Discover more about diseases related to MCF2L2 Antibody (NBP1-90851).

Blogs on MCF2L2

There are no specific blogs for MCF2L2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MCF2L2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MCF2L2