MBP-1 Recombinant Protein Antigen

Images

 
There are currently no images for MBP-1 Recombinant Protein Antigen (NBP1-88573PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MBP-1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MBP-1.

Source: E. coli

Amino Acid Sequence: GSGSEDASKKDGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGCQTCRYLLVRSLQTFSQAWFTCRRC

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PRG2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88573.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MBP-1 Recombinant Protein Antigen

  • BMPG
  • BMPGeosinophil major basic protein
  • bone marrow proteoglycan
  • bone-marrow proteoglycan
  • EMBP
  • MBP1
  • MBP-1
  • MBPeosinophil granule major basic protein
  • MGC14537
  • natural killer cell activator
  • PRG2
  • proteoglycan 2 preproprotein
  • Proteoglycan 2
  • proteoglycan 2, bone marrow (natural killer cell activator, eosinophil granulemajor basic protein)

Background

PRG2, also known as Bone marrow proteoglycan, is a 222 amino acid protein that is 25 kDa, found in high levels of the proform in placenta and pregnancy serum, may be involved in antiparasitic defense mechanisms as a cytotoxin and helminthotoxin, and in immune hypersensitivity reactions; is directly implicated in epithelial cell damage, exfoliation, and bronchospasm in allergic diseases; and the proform acts as a proteinase inhibitor, reducing the activity of PAPPA. Disease research is currently being studied in relation to PRG2 and malignant peripheral nerve sheath tumor, epithelioid malignant peripheral nerve sheath tumor, ocular cicatricial pemphigoid, cicatricial pemphigoid, giant papillary conjunctivitis, vernal keratoconjunctivitis, corneal ulcer, allergic rhinitis, eosinophilic gastroenteritis, papillary conjunctivitis, hypereosinophilic syndrome, eosinophilia, pulmonary eosinophilia,connective tissue disease, kimura disease, rhinitis, retinal detachment, keratoconjunctivitis, eosinophilic esophagitis, and familial eosinophilia. The protein has been shown to interact with CHD3, PAPPA, PRKCZ, AGT, CSF2, and other proteins in MAPK Signaling, Molecular Mechanisms of Cancer, PTEN Pathway, Transendothelial Migration of Leukocytes, UPA-UPAR Pathway, Selected targets of C/EBPbeta and Asthma pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87781
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
538-MG
Species: Rt
Applications: BA
H00004340-B01P
Species: Hu, Rt
Applications: WB
MAB6734
Species: Hu
Applications: IHC
AF5724
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP2-93574
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
485-MI
Species: Mu
Applications: BA
6507-IL/CF
Species: Hu
Applications: BA
202-IL
Species: Hu
Applications: BA
7954-GM/CF
Species: Hu
Applications: BA
NBP1-88027
Species: Eq, Hu, Mu, Rt
Applications: IHC,  IHC-P, Simple Western, WB
NBP2-83997
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-46005
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, PLA, WB
NBP2-42388
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-33778
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-46617
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
DY417
Species: Mu
Applications: ELISA

Publications for MBP-1 Recombinant Protein Antigen (NBP1-88573PEP) (0)

There are no publications for MBP-1 Recombinant Protein Antigen (NBP1-88573PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MBP-1 Recombinant Protein Antigen (NBP1-88573PEP) (0)

There are no reviews for MBP-1 Recombinant Protein Antigen (NBP1-88573PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MBP-1 Recombinant Protein Antigen (NBP1-88573PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MBP-1 Products

Research Areas for MBP-1 Recombinant Protein Antigen (NBP1-88573PEP)

Find related products by research area.

Blogs on MBP-1

There are no specific blogs for MBP-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MBP-1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PRG2