MBOAT7 Antibody

Images

 
Western Blot: MBOAT7 Antibody [NBP1-69610] - This Anti-LENG4 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 5ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MBOAT7 Antibody Summary

Immunogen
Synthetic peptides corresponding to LENG4 The peptide sequence was selected from the C terminal of LENG4. Peptide sequence LSAYWHGLHPGYYLSFLTIPLCLAAEGRLESALRGRLSPGGQKAWDWVHW.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MBOAT7
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against LENG4 and was validated on Western blot.
Theoretical MW
53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using
NBP1-69610 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MBOAT7 Antibody

  • 1-acylglycerophosphatidylinositol O-acyltransferase
  • BB1LPLAT 7
  • Bladder and breast carcinoma-overexpressed gene 1 protein
  • EC 2.3.1.-
  • EC 2.3.1.n4
  • h-mboa-7
  • hMBOA-7
  • LENG4FLJ41296
  • leukocyte receptor cluster (LRC) member 4
  • Leukocyte receptor cluster member 4
  • LPIATO-acyltransferase domain-containing protein 7
  • LRC4
  • Lysophosphatidylinositol acyltransferase
  • lysophospholipid acyltransferase 7
  • Lyso-PI acyltransferase
  • malignant cell expression-enhanced gene/tumor progression-enhanced
  • MBOA7
  • membrane bound O-acyltransferase domain containing 7
  • Membrane-bound O-acyltransferase domain-containing protein 7
  • OACT7

Background

The function remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB140
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
MAB342
Species: Hu
Applications: WB, AgAct
796-IC
Species: Mu
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-25208
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NLS830
Species: Hu, Po, Bt, Ca, Eq, Mk, Pm, Rb
Applications: WB, IHC, IHC-P
NBP2-22542
Species: Hu
Applications: WB, B/N, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-04299
Species: Hu
NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
NB500-328
Species: Hu
Applications: Flow, IP, CyTOF-ready

Publications for MBOAT7 Antibody (NBP1-69610)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for MBOAT7 Antibody (NBP1-69610) (0)

There are no reviews for MBOAT7 Antibody (NBP1-69610). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MBOAT7 Antibody (NBP1-69610) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MBOAT7 Products

Bioinformatics Tool for MBOAT7 Antibody (NBP1-69610)

Discover related pathways, diseases and genes to MBOAT7 Antibody (NBP1-69610). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MBOAT7 Antibody (NBP1-69610)

Discover more about diseases related to MBOAT7 Antibody (NBP1-69610).
 

Pathways for MBOAT7 Antibody (NBP1-69610)

View related products by pathway.

Blogs on MBOAT7

There are no specific blogs for MBOAT7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MBOAT7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MBOAT7
Uniprot