MBOAT7 Antibody


Western Blot: MBOAT7 Antibody [NBP1-62511] - Human Brain lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

MBOAT7 Antibody Summary

Synthetic peptides corresponding to LENG4 The peptide sequence was selected from the C terminal of LENG4 (NM_024298). Peptide sequence WWLAQYIYKSAPARSYVLRSAWTMLLSAYWHGLHPGYYLSFLTIPLCLAA.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Theoretical MW
53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MBOAT7 Antibody

  • 1-acylglycerophosphatidylinositol O-acyltransferase
  • BB1LPLAT 7
  • Bladder and breast carcinoma-overexpressed gene 1 protein
  • EC 2.3.1.-
  • EC 2.3.1.n4
  • h-mboa-7
  • hMBOA-7
  • LENG4FLJ41296
  • leukocyte receptor cluster (LRC) member 4
  • Leukocyte receptor cluster member 4
  • LPIATO-acyltransferase domain-containing protein 7
  • LRC4
  • Lysophosphatidylinositol acyltransferase
  • lysophospholipid acyltransferase 7
  • Lyso-PI acyltransferase
  • malignant cell expression-enhanced gene/tumor progression-enhanced
  • MBOA7
  • membrane bound O-acyltransferase domain containing 7
  • Membrane-bound O-acyltransferase domain-containing protein 7
  • OACT7


MBOAT7 belongs to the membrane-bound acyltransferase family. It is involved in arachidonate recycling, thus regulating free arachidonic acid levels and leukotriene synthesis in neutrophils.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Mu
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu, Po, Bt, Ca, Eq, Mk, Pm, Rb
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IP, B/N
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Species: Hu
Applications: Flow, AdBlk, CyTOF-ready, ICC
Species: Hu
Applications: Flow, IP, CyTOF-ready

Publications for MBOAT7 Antibody (NBP1-62511) (0)

There are no publications for MBOAT7 Antibody (NBP1-62511).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MBOAT7 Antibody (NBP1-62511) (0)

There are no reviews for MBOAT7 Antibody (NBP1-62511). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MBOAT7 Antibody (NBP1-62511) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for MBOAT7 Antibody (NBP1-62511)

Discover related pathways, diseases and genes to MBOAT7 Antibody (NBP1-62511). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MBOAT7 Antibody (NBP1-62511)

Discover more about diseases related to MBOAT7 Antibody (NBP1-62511).

Pathways for MBOAT7 Antibody (NBP1-62511)

View related products by pathway.

Blogs on MBOAT7

There are no specific blogs for MBOAT7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MBOAT7 Antibody and receive a gift card or discount.


Gene Symbol MBOAT7