Home » MAZ » MAZ Antibodies » MAZ Antibody

MAZ Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: MAZ Antibody [NBP2-57338] - Staining of human cell line MCF7 shows localization to nucleoplasm.
Immunocytochemistry/ Immunofluorescence: MAZ Antibody [NBP2-57338] - Staining of human cell line MCF7 shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

MAZ Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AHTVRHEEKVPCHVCGKMLSSAYISDHMKVHSQGPHHVCELCNKGTGEVCPMA
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAZ
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MAZ Recombinant Protein Antigen (NBP2-57338PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for MAZ Antibody

  • MAZI
  • MYC-associated zinc finger protein (purine-binding transcription factor)
  • myc-associated zinc finger protein
  • PUR1
  • Pur-1SAF-2
  • Purine-binding transcription factor
  • serum amyloid A activating factor 1
  • serum amyloid A activating factor 2
  • Transcription factor Zif87
  • ZF87SAF-1
  • Zif87
  • Zinc finger protein 801
  • zinc-finger protein, 87 kilodaltons
  • ZNF801SAF-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

SP1 Antibody
NB600-232
Western Blot: SP1 Antibody [NB600-232] - A. Whole cell lysate (50 ug for E; 10 ug for T) from HEK 293T cells that were mock transfected (E) or transfected with an Sp1 expression construct (T). B. Whole cell lysate (~700 ug) from HEK 293T cells. A. Affinity purified rabbit anti-Sp1 antibody used at the indicated concentrations. B. SP1 was immunoprecipitated using affinity purified rabbit anti-SP1 antibodies BL937, using each antibody at 3.75 ug/mg lysate. Subsequently, was used at 0.04 ug/mL for WB. Detection by chemiluminescence with an exposure time of 10 seconds (A) or 1 min (B).
Immunohistochemistry-Paraffin: SP1 Antibody [NB600-232] - FFPE sections of human breast carcinoma (left) and mouse squamous cell carcinoma (right). Affinity purified rabbit anti-Sp1 used at a dilution of 1:1,000 (1 ug/mL). Detection by DAB.
Western Blot: SP1 Antibody [NB600-232] - Detection of Human SP1 by Western Blot. Whole cell lysate (50 ug) from HeLa and 293T cells prepared using NETN lysis buffer. Affinity purified rabbit anti-SP1 antibody (NB600-232) used for WB at 0.04 ug/mL. Detection by chemiluminescence with an exposure time of 3 minutes.
(1 Review)
(6 Publications)
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
COCO/DAND5
Antibody (OTI2H3)
NBP2-01223
Flow Cytometry: DAND5 Antibody (2H3) [NBP2-01223] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-DAND5 antibody, and then analyzed by flow cytometry.
Western Blot: DAND5 Antibody (2H3) [NBP2-01223] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY DAND5 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-DAND5.
Immunohistochemistry-Paraffin: DAND5 Antibody (2H3) [NBP2-01223] - Staining of paraffin-embedded Adenocarcinoma of Human breast tissue using anti-DAND5 mouse monoclonal antibody.
Species: Hu
Applications: Flow, IHC, IHC-P, WB
PSG1 [HRP]
DPSG10
(2 Publications)
Species: Hu
Applications: ELISA
c-Myc Antibody
(9E10) - BSA Free
NB600-302
Flow Cytometry: c-Myc Antibody (9E10) [NB600-302] - An intracellular stain was performed on U-937 cells with c-Myc Antibody (9E10) NB600-302AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow Cytometry: c-Myc Antibody (9E10) [NB600-302] - An intracellular stain was performed on Jurkat cells with c-Myc Antibody (9E10) NB600-302R (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 550.
Western Blot: c-Myc Antibody (9E10) [NB600-302] - CtIP is phosphorylated by CDKs at multiple sites. Myc-BRCA1 and/or HA-CtIP WT or indicated mutants were expressed in 293T cells and co-immunoprecipitation was performed. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pgen.1003277) licensed under a CC-BY licence.
(4 Reviews)
(36 Publications)
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
IL-6 [HRP]
D6050
(32 Reviews)
(588 Publications)
Species: Hu
Applications: ELISA
Exosome component
10 Antibody
NBP1-32870
Western Blot: Exosome component 10 Antibody [NBP1-32870] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with EXOSC10 antibody diluted at 1:5000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-32870] - Paraffin-embedded Cal27 xenograft, using antibody at 1:100 dilution.
Western Blot: Exosome component 10 Antibody [NBP1-32870] - Sample: 1000 ug 293T whole cell lysate/extract A. 30 ug 293T whole cell lysate/extract, B. Control with 2. 5 ug of preimmune rabbit IgG, C. Immunoprecipitation of EXOSC 10 protein by 2. 5 ug of EXOSC 10 antibody 7. 5% SDS-PAGE gel.
(2 Reviews)
(3 Publications)
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
RPLP2 Antibody
NBP2-15104
Immunocytochemistry/Immunofluorescence: RPLP2 Antibody [NBP2-15104] - Analysis of methanol-fixed A431, using antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: RPLP2 Antibody [NBP2-15104] - Human colon carcinoma, using RPLP2 antibody at 1:500 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
Western Blot: RPLP2 Antibody [NBP2-15104] - Sample (30 ug of whole cell lysate) A: 293T 15% SDS PAGE diluted at 1:10000 The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

FABP8/M-FABP/Myelin P2
AF5866
Western blot shows lysates of human hippocampal and rat spinal cord tissue. PVDF membrane was probed with 1 µg/mL of Human FABP8 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5866) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for FABP8 at approximately 15 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 7.
FABP8 was detected in immersion fixed paraffin-embedded sections of human spinal cord using 15 µg/mL Human FABP8 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5866) overnight at 4 °C. Tissue was stained with the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
FABP8 was detected in immersion fixed paraffin-embedded sections of human brain (cortex) using Human FABP8 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5866) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu
Applications: IHC, WB
VEGF [HRP]
DVE00
(26 Reviews)
(580 Publications)
Species: Hu
Applications: ELISA
EGR1 Antibody (6E8)
H00001958-M03
Western Blot: EGR1 Antibody (6E8) [H00001958-M03] - Analysis of EGR1 expression in transfected 293T cell line by EGR1 monoclonal antibody (M03), clone 6E8. Lane 1: EGR1 transfected lysatE (59.73 KDa). Lane 2: Non-transfected lysate.
Western Blot: EGR1 Antibody (6E8) [H00001958-M03] - EGR1 monoclonal antibody (M03), clone 6E8. Western Blot analysis of EGR1 expression in Raw 264.7.
Western Blot: EGR1 Antibody (6E8) [H00001958-M03] - EGR1 monoclonal antibody (M03), clone 6E8. Western Blot analysis of EGR1 expression in PC-12.
(2 Publications)
Species: Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
PNMT Antibody
(OTI1D2)
NBP2-00688
Western Blot: PNMT Antibody (OTI1D2) [NBP2-00688] - Analysis of extracts (10ug) from 9 Human tissue by using anti-PNMT monoclonal antibody at 1:200 (1: Testis; 2: Omentum; 3: Uterus; 4: Breast; 5: Brain; 6: Liver; 7: Ovary; 8: Thyroid gland; 9: colon).
Western Blot: PNMT Antibody (1D2) [NBP2-00688] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY PNMT (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-PNMT.
Immunohistochemistry-Paraffin: PNMT Antibody (1D2) [NBP2-00688] - Staining of paraffin-embedded Adenocarcinoma of Human endometrium tissue using anti-PNMT mouse monoclonal antibody.
(2 Publications)
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
GLS2 Antibody -
BSA Free
NBP1-76544
Western Blot: GLS2 Antibody [NBP1-76544] - Glutaminase protein expression in PC3 and PC3M cell lines before/after CB-839 treatment. PC3 & PC3M cells were treated (+) or not treated (-) with GLS1 inhibitor CB-839 (1 uM) and their expression of GLS1 & GLS2 proteins determined by Western blot. Antibodies specific for GAC & KCA were utilized on two replicate samples, while GLS2 expression was determined on three. PC3 cell lysates expressed GLS2 more than PC3M cell lysates regardless of CB-839 treatment. The difference in GLS2 expression was significant in the untreated cells (P?<?0.03) but because of high variability the difference was not significant in the drug-treated cells. Levels of GLS1 (GAC and KGA) were similar in all cell lysates. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-017-16327-z), licensed under a CC-BY licence.
Immunohistochemistry: GLS2 Antibody [NBP1-76544] - Immunohistochemistry of GLS2 in human kidney tissue with GLS2 antibody at 5 ug/mL.
Immunocytochemistry/Immunofluorescence: GLS2 Antibody [NBP1-76544] - of GLS2 in Human Kidney cells. Dilution 20 ug/mL.
(5 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
AGA Antibody
NBP1-88866
Immunohistochemistry-Paraffin: AGA Antibody [NBP1-88866] - Staining of human epididymis shows high expression.
Immunohistochemistry-Paraffin: AGA Antibody [NBP1-88866] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: AGA Antibody [NBP1-88866] - Staining in human epididymis and skeletal muscle tissues using anti-AGA antibody. Corresponding AGA RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
c-jun [p Ser63]
Antibody (SY0297)
NBP2-67471
Immunocytochemistry/Immunofluorescence: c-jun [p Ser63] Antibody (SY0297) [NBP2-67471] - Staining Phospho-c-Jun(S63) in A549 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: c-jun [p Ser63] Antibody (SY0297) [NBP2-67471] - Staining Phospho-c-Jun(S63) in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: c-jun [p Ser63] Antibody (SY0297) [NBP2-67471] - Analysis of paraffin-embedded human breast carcinoma tissue using anti-Phospho-c-Jun(S63) antibody. Counter stained with hematoxylin.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Insulin was detected in immersion fixed beta TC‑6 mouse beta cell insulinoma cell line using Human/Mouse/Bovine Insulin Monoclonal Antibody (Catalog # MAB1417) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(14 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
PTH Antibody
(918462) [Unconjugate
MAB7665
PTH was detected in immersion fixed paraffin-embedded sections of human parathyroid gland using Mouse Anti-Human PTH Monoclonal Antibody (Catalog # MAB7665) at 5 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific staining was localized to cell membranes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of human parathyroid tissue. PVDF membrane was probed with 2 µg/mL of Mouse Anti-Human PTH Monoclonal Antibody (Catalog # MAB7665) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for PTH at approximately 12 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: IHC, WB
PPAR gamma/NR1C3
Antibody - BSA Free
NBP2-22106
Western Blot: PPAR gamma/NR1C3 Antibody [NBP2-22106] - Total protein from 3T3-L1 mouse embryonic fibroblast adipose-like cell line, separated by 4-12% SDS-PAGE, transferred to nitrocellulose membrane and blocked in 5% non-fat milk for 1h at room temperature. The membrane was probed with anti-PPAR gamma 1:800 in non-fat milk. Lane 2-7 increasing protein concentration, undifferentiated adipocytes. Lane 8-13 increasing protein concentration, differentiated adipocytes. This image was submitted via customer review.
Immunohistochemistry-Paraffin: PPAR gamma Antibody [NBP2-22106] - IHC analysis of PPAR gamma in mouse liver.
Western Blot: PPAR gamma Antibody [NBP2-22106] - Western blot analysis of PPAR gamma in 1. human adipose and 2. human adrenal lysate.
(2 Reviews)
(6 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(36 Reviews)
(702 Publications)
Species: Hu
Applications: BA

Publications for MAZ Antibody (NBP2-57338) (0)

There are no publications for MAZ Antibody (NBP2-57338).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAZ Antibody (NBP2-57338) (0)

There are no reviews for MAZ Antibody (NBP2-57338). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MAZ Antibody (NBP2-57338) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAZ Products

Array NBP2-57338

Bioinformatics Tool for MAZ Antibody (NBP2-57338)

Discover related pathways, diseases and genes to MAZ Antibody (NBP2-57338). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAZ Antibody (NBP2-57338)

Discover more about diseases related to MAZ Antibody (NBP2-57338).
 

Pathways for MAZ Antibody (NBP2-57338)

View related products by pathway.

PTMs for MAZ Antibody (NBP2-57338)

Learn more about PTMs related to MAZ Antibody (NBP2-57338).

Blogs on MAZ

There are no specific blogs for MAZ, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAZ Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol MAZ