Matrilin-1 Antibody - BSA Free

Western Blot: Matrilin-1 Antibody [NBP1-70634] - OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.

Western Blot: Matrilin-1 Antibody [NBP1-70634] - Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1 : 12500 Positive control: OVCAR-3 cell lysate MATN1 is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Matrilin-1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to MATN1(matrilin 1, cartilage matrix protein) The peptide sequence was selected from the middle region of MATN1 (NP_002370). Peptide sequence KYLIDNSFTVSSGARPGAQKVGIVFTDGRSQDYINDAAKKAKDLGFKMFA. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MATN1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 54 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Matrilin-1 Antibody - BSA Free

• cartilage matrix protein
• CMP
• CRTM
• MATN1
• matrilin 1, cartilage matrix protein
• Matrilin1
• Matrilin-1

Background

This gene encodes a member of von Willebrand factor A domain containing protein family. This family of proteins are thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. Mutations of this gene ha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MATN1
• Entrez:
  • 4146(Human)
• Uniprot:
  • P21941(Human)