Matrilin-1 Antibody


Western Blot: Matrilin-1 Antibody [NBP1-70634] - OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: Matrilin-1 Antibody [NBP1-70634] - Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1 : 12500 Positive control: OVCAR-3 cell lysate MATN1 is strongly supported by BioGPS gene expression data to be expressed more

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Matrilin-1 Antibody Summary

Synthetic peptides corresponding to MATN1(matrilin 1, cartilage matrix protein) The peptide sequence was selected from the middle region of MATN1 (NP_002370). Peptide sequence KYLIDNSFTVSSGARPGAQKVGIVFTDGRSQDYINDAAKKAKDLGFKMFA.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Theoretical MW
54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Matrilin-1 Antibody

  • cartilage matrix protein
  • CMP
  • CRTM
  • MATN1
  • matrilin 1, cartilage matrix protein
  • Matrilin1
  • Matrilin-1


This gene encodes a member of von Willebrand factor A domain containing protein family. This family of proteins are thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. Mutations of this gene ha


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt, Ch, Rb
Applications: WB, IHC, IHC-Fr, IHC-P, IF
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, ELISA

Publications for Matrilin-1 Antibody (NBP1-70634) (0)

There are no publications for Matrilin-1 Antibody (NBP1-70634).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Matrilin-1 Antibody (NBP1-70634) (0)

There are no reviews for Matrilin-1 Antibody (NBP1-70634). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Matrilin-1 Antibody (NBP1-70634) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Matrilin-1 Products

Bioinformatics Tool for Matrilin-1 Antibody (NBP1-70634)

Discover related pathways, diseases and genes to Matrilin-1 Antibody (NBP1-70634). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Matrilin-1 Antibody (NBP1-70634)

Discover more about diseases related to Matrilin-1 Antibody (NBP1-70634).

Pathways for Matrilin-1 Antibody (NBP1-70634)

View related products by pathway.

Blogs on Matrilin-1

There are no specific blogs for Matrilin-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Matrilin-1 Antibody and receive a gift card or discount.


Gene Symbol MATN1