PPP6C Antibody


Western Blot: PPP6C Antibody [NBP2-13804] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: PPP6C Antibody [NBP2-13804] - Staining of human tonsil shows moderate cytoplasmic positivity in germinal center cells.
Immunohistochemistry-Paraffin: PPP6C Antibody [NBP2-13804] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: PPP6C Antibody [NBP2-13804] - Staining of human stomach shows moderate to strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: PPP6C Antibody [NBP2-13804] - Staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC

Order Details

PPP6C Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: CYRCGNIASIMVFKDVNTREPKLFRAVPDSERVIPPRTTTPYFL
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PPP6C Protein (NBP2-13804PEP)
Read Publication using NBP2-13804.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PPP6C Antibody

  • EC
  • FLJ92648
  • MGC12249
  • PP6
  • PP6C
  • PPP6
  • protein phosphatase 6, catalytic subunit
  • serine/threonine protein phosphatase catalytic subunit
  • serine/threonine-protein phosphatase 6 catalytic subunit


Protein phosphatase 6C belongs to the PPP phosphatase family, PP-V subfamily, and may function in cell cycle regulation.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: Flow-CS, Flow, ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IP, Neut, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA

Publications for PPP6C Antibody (NBP2-13804)(1)

Reviews for PPP6C Antibody (NBP2-13804) (0)

There are no reviews for PPP6C Antibody (NBP2-13804). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPP6C Antibody (NBP2-13804) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PPP6C Antibody and receive a gift card or discount.


Gene Symbol PPP6C