PPP6C Antibody

Images

 
Western Blot: PPP6C Antibody [NBP2-13804] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: PPP6C Antibody [NBP2-13804] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PPP6C Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: CYRCGNIASIMVFKDVNTREPKLFRAVPDSERVIPPRTTTPYFL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPP6C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PPP6C Protein (NBP2-13804PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PPP6C Antibody

  • EC 3.1.3.16
  • FLJ92648
  • MGC12249
  • PP6
  • PP6C
  • PPP6
  • protein phosphatase 6, catalytic subunit
  • serine/threonine protein phosphatase catalytic subunit
  • serine/threonine-protein phosphatase 6 catalytic subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB5074
Species: Hu
Applications: WB
NBP2-52414
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready, ICC, IF
NBP1-87232
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NLS1071
Species: Hu
Applications: IHC-P
NBP1-47927
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-31266
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34049
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24449
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow
MAB2545
Species: Hu
Applications: WB, IHC, IP
NBP1-87239
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-48803
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47289
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83126
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-88014
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85169
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-13804
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for PPP6C Antibody (NBP2-13804) (0)

There are no publications for PPP6C Antibody (NBP2-13804).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPP6C Antibody (NBP2-13804) (0)

There are no reviews for PPP6C Antibody (NBP2-13804). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPP6C Antibody (NBP2-13804) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PPP6C Products

Bioinformatics Tool for PPP6C Antibody (NBP2-13804)

Discover related pathways, diseases and genes to PPP6C Antibody (NBP2-13804). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPP6C Antibody (NBP2-13804)

Discover more about diseases related to PPP6C Antibody (NBP2-13804).
 

Pathways for PPP6C Antibody (NBP2-13804)

View related products by pathway.

PTMs for PPP6C Antibody (NBP2-13804)

Learn more about PTMs related to PPP6C Antibody (NBP2-13804).
 

Research Areas for PPP6C Antibody (NBP2-13804)

Find related products by research area.

Blogs on PPP6C

There are no specific blogs for PPP6C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPP6C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP6C