MAST3 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: TPTFAERSFSEDREEGWERSEVDYGRRLSADIRLRSWTSSGSSCQSSSSQPERGPSPSLLNTISLDTMPKFA |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MAST3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for MAST3 Antibody - BSA Free
Background
Microtubule associated serine/threonine kinase 3 or MAST3 is involved with protein phosphorylation. Belonging to the AGC Ser/Thr protein kinase family, MAST3 are cytoskeletal kinases associated with ATP binding, magnesium ion binding, protein binding and protein serine/threonine kinase activity. Popular protein domains for MAST3 include PDZ, protein kinase, AGC-kinase C-terminal domain and domain of unknown function (DUF1908). MAST3 is also known to interact with PTEN, PRKAB2, PRKAA2, CNTNAP4 and YWHAH.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: KO, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IP, Simple Western, WB
Species: Hu, Mu
Applications: WB
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Ha, Hu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC
Publications for MAST3 Antibody (NBP1-82992) (0)
There are no publications for MAST3 Antibody (NBP1-82992).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MAST3 Antibody (NBP1-82992) (0)
There are no reviews for MAST3 Antibody (NBP1-82992).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for MAST3 Antibody (NBP1-82992) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MAST3 Products
Research Areas for MAST3 Antibody (NBP1-82992)
Find related products by research area.
|
Blogs on MAST3