MAST3 Antibody

Images

 
Immunohistochemistry-Paraffin: MAST3 Antibody [NBP1-82992] - Staining of human duodenum shows moderate positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAST3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TPTFAERSFSEDREEGWERSEVDYGRRLSADIRLRSWTSSGSSCQSSSSQPERGPSPSLLNTISLDTMPKFA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAST3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MAST3 Protein (NBP1-82992PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MAST3 Antibody

  • EC 2.7.11
  • KIAA0561EC 2.7.11.1
  • microtubule associated serine/threonine kinase 3
  • microtubule-associated serine/threonine-protein kinase 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87899
Species: Hu
Applications: IHC, IHC-P
NBP1-83017
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF7117
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-15910
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1229
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP2-17228
Species: Mu
Applications: WB
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-00955
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P
H00009223-M03
Species: Hu, Rt, Ca, Ha
Applications: WB, ELISA, ICC/IF
NB100-2883
Species: Hu, Mu
Applications: WB, IP
NBP1-77533
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-P, IP, CyTOF-ready
AF4937
Species: Hu
Applications: WB, IHC
NBP1-30557
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-47559
Species: Hu
Applications: WB, IHC, IHC-P
H00150094-D01P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
NBP2-46667
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MAST3 Antibody (NBP1-82992) (0)

There are no publications for MAST3 Antibody (NBP1-82992).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAST3 Antibody (NBP1-82992) (0)

There are no reviews for MAST3 Antibody (NBP1-82992). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MAST3 Antibody (NBP1-82992) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAST3 Products

Bioinformatics Tool for MAST3 Antibody (NBP1-82992)

Discover related pathways, diseases and genes to MAST3 Antibody (NBP1-82992). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAST3 Antibody (NBP1-82992)

Discover more about diseases related to MAST3 Antibody (NBP1-82992).
 

Pathways for MAST3 Antibody (NBP1-82992)

View related products by pathway.

PTMs for MAST3 Antibody (NBP1-82992)

Learn more about PTMs related to MAST3 Antibody (NBP1-82992).
 

Research Areas for MAST3 Antibody (NBP1-82992)

Find related products by research area.

Blogs on MAST3

There are no specific blogs for MAST3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAST3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAST3