Mark3 Antibody (1A10)

Images

 
Western Blot: Mark3 Antibody (1A10) [H00004140-M01] - Analysis of MARK3 expression in transfected 293T cell line by MARK3 monoclonal antibody (M01), clone 1A10.Lane 1: MARK3 transfected lysate(81.4 KDa).Lane 2: ...read more
Sandwich ELISA: Mark3 Antibody (1A10) [H00004140-M01] - Detection limit for recombinant GST tagged MARK3 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1A10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Mark3 Antibody (1A10) Summary

Immunogen
MARK3 (NP_002367.4 402 a.a. - 500 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HHKVQRSVFSSQKQRRYSDHAGPAIPSVVAYPKRSQTSTADSDLKEDGISSRKSSGSAVGGKGIAPASPMLGNASNPNKADIPERKKSSTVPSSNTASG
Specificity
MARK3 - MAP/microtubule affinity-regulating kinase 3 (1A10)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MARK3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Mark3 Antibody (1A10)

  • Cdc25C-associated protein kinase 1
  • cTAK1
  • C-TAK1
  • CTAK1ELKL motif kinase 2
  • EC 2.7.11
  • EC 2.7.11.1
  • EMK2
  • EMK-2
  • KP78
  • MAP/microtubule affinity-regulating kinase 3
  • PAR1A
  • Protein kinase STK10
  • Ser/Thr protein kinase PAR-1
  • Serine/threonine-protein kinase p78

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-78028
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, ICC/IF
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-33409
Species: Hu
Applications: WB, ICC/IF
NBP1-33687
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Other, Pm
Applications: WB, Simple Western
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NBP2-14835
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45755
Species: Hu
Applications: WB, IHC
NBP1-82863
Species: Hu
Applications: IHC, IHC-P
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56561
Species: Hu, Mu, Rt
Applications: WB
NBP2-49382
Species: Hu
Applications: IHC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NB100-56508
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
H00004140-M01
Species: Hu
Applications: WB, ELISA

Publications for Mark3 Antibody (H00004140-M01) (0)

There are no publications for Mark3 Antibody (H00004140-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Mark3 Antibody (H00004140-M01) (0)

There are no reviews for Mark3 Antibody (H00004140-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Mark3 Antibody (H00004140-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Mark3 Products

Bioinformatics Tool for Mark3 Antibody (H00004140-M01)

Discover related pathways, diseases and genes to Mark3 Antibody (H00004140-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Mark3 Antibody (H00004140-M01)

Discover more about diseases related to Mark3 Antibody (H00004140-M01).
 

Pathways for Mark3 Antibody (H00004140-M01)

View related products by pathway.

PTMs for Mark3 Antibody (H00004140-M01)

Learn more about PTMs related to Mark3 Antibody (H00004140-M01).
 

Research Areas for Mark3 Antibody (H00004140-M01)

Find related products by research area.

Blogs on Mark3

There are no specific blogs for Mark3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Mark3 Antibody (1A10) and receive a gift card or discount.

Bioinformatics

Gene Symbol MARK3
Entrez
Uniprot