MARCH5 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MARCH5 Antibody [NBP2-56779] - Staining of human cell line U-251 MG shows localization to mitochondria.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MARCH5 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PDQALQQMLDRSCWVCFATDEDDRTAEWVRPCRCRGSTKWVHQACLQRWVDEKQRGNSTARVACPQCNAEYLIVFPKLGPVVYVLDLA
Specificity
Specificity of human MARCH5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MARCH5
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MARCH5 Recombinant Protein Antigen (NBP2-56779PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for MARCH5 Antibody

  • E3 ubiquitin-protein ligase MARCH5
  • EC 6.3.2
  • EC 6.3.2.-
  • FLJ20445
  • MARCH-VRNF153
  • membrane-associated ring finger (C3HC4) 5
  • Membrane-associated RING finger protein 5
  • Membrane-associated RING-CH protein V
  • Mitochondrial ubiquitin ligase
  • RING finger protein 153MITOL

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-55288
Species: Hu, Mu, Rt, Fi, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-84074
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13913
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31363
Species: Hu
Applications: WB, ICC/IF
NBP2-75449
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-02477
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-24906
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC, IF
NBP2-66383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-26506
Species: Hu, Mu, Rt
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NB100-56646
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
H00055669-M04
Species: Hu, Mu
Applications: WB, ELISA, Flow
NBP1-87863
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NB100-41398
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-56144
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-42827
Species: Hu, Mu, Rt, Ch, Fi, Re, Xp
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-92298
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MARCH5 Antibody (NBP2-56779) (0)

There are no publications for MARCH5 Antibody (NBP2-56779).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MARCH5 Antibody (NBP2-56779) (0)

There are no reviews for MARCH5 Antibody (NBP2-56779). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MARCH5 Antibody (NBP2-56779) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for MARCH5 Antibody (NBP2-56779)

Discover related pathways, diseases and genes to MARCH5 Antibody (NBP2-56779). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MARCH5 Antibody (NBP2-56779)

Discover more about diseases related to MARCH5 Antibody (NBP2-56779).
 

Pathways for MARCH5 Antibody (NBP2-56779)

View related products by pathway.

PTMs for MARCH5 Antibody (NBP2-56779)

Learn more about PTMs related to MARCH5 Antibody (NBP2-56779).
 

Research Areas for MARCH5 Antibody (NBP2-56779)

Find related products by research area.

Blogs on MARCH5

There are no specific blogs for MARCH5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MARCH5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MARCH5