MARCH1 Antibody - BSA Free

Immunohistochemistry-Paraffin: MARCH1 Antibody [NBP1-91637] - Staining of human spleen shows moderate cytoplasmic positivity in cells in red pulp and white pulp.

Staining of human lung shows weak cytoplasmic positivity in macrophages.

Staining of human skeletal muscle shows very weak cytoplasmic positivity in myocytes as expected.

Staining of human spleen shows strong granular cytoplasmic positivity in cells in red pulp.

Staining of human small intestine shows moderate granular cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MARCH1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MARCH1 Antibody - BSA Free (NBP1-91637) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KVYVQLWRRLKAYNRVIFVQNCPDTAKKLEKNFSCNVNTDIKDAVVVPVPQTGANSLPSAEGG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MARCH1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin: HIER pH 6 retrieval method is recommended.
• Theoretical MW: 32 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  MARCH1 Protein (NBP1-91637PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MARCH1 Antibody - BSA Free

• E3 ubiquitin-protein ligase MARCH1
• EC 6.3.2
• EC 6.3.2.-
• MARCH-IDKFZp564M1682
• membrane-associated ring finger (C3HC4) 1
• Membrane-associated RING finger protein 1
• Membrane-associated RING-CH protein I
• RING finger protein 171
• RNF171FLJ20668

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MARCH1
• Entrez:
  • 55016(Human)
• Uniprot:
  • Q8TCQ1(Human)