MAP4K6 Antibody - BSA Free

Western Blot: MAP4K6 Antibody [NBP2-49220] - Analysis in human cell lines A-549 and U2OS using anti-MINK1 antibody. Corresponding MINK1 RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.

Staining of human skin shows strong cytoplasmic positivity in squamous epithelial cells.

Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MAP4K6 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MAP4K6 Antibody - BSA Free (NBP2-49220) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ARPRSNSAWQIYLQRRAERGTPKPPGPPAQPPGPPNASSNPDLRRSDPGWERSDSVLPASHGHL
• Predicted Species: Mouse (100%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MINK1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MAP4K6 Recombinant Protein Antigen (NBP2-49220PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MAP4K6 Antibody - BSA Free

• B55
• EC 2.7.11
• GCK family kinase MiNK
• hMINK
• hMINKbeta
• MAP4K6EC 2.7.11.1
• MAPK/ERK kinase kinase kinase 6
• MEK kinase kinase 6
• MGC21111
• MINKMEKKK 6
• Misshapen/NIK-related kinase
• misshapen-like kinase 1 (zebrafish)
• misshapen-like kinase 1
• Mitogen-activated protein kinase kinase kinase kinase 6
• serine/threonine protein kinase
• YSK2
• ZC3

Background

MINK1 (misshapen/NIKs-related kinase 1) is a member of the germinal center kinase (GCK) family that are homologous to the yeast sterile 20 (Ste20) kinases. GCKs function in the activation of the JNK pathway. MINK1 has been found to activate the JNK pathway and may have a role in modulating cytoskeletal organization, cell adhesion, and cell migration during development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MINK1