MAP4K2 Antibody

Images

 
Western Blot: MAP4K2 Antibody [NBP1-58851] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, GP, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAP4K2 Antibody Summary

Immunogen
Synthetic peptides corresponding to MAP4K2(mitogen-activated protein kinase kinase kinase kinase 2) The peptide sequence was selected from the N terminal of MAP4K2. Peptide sequence TVTSELAAVKIVKLDPGDDISSLQQEITILRECRHPNVVAYIGSYLRNDR.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAP4K2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against MAP4K2 and was validated on Western blot.
Theoretical MW
91 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MAP4K2 Antibody

  • B lymphocyte serine/threonine protein kinase
  • B lymphocyte serine/threonine-protein kinase
  • BL44
  • EC 2.7.11
  • EC 2.7.11.1
  • GC kinase
  • GCKMEK kinase kinase 2
  • Germinal center kinase
  • germinal centre kinase (GC kinase)
  • MAPK/ERK kinase kinase kinase 2
  • mitogen-activated protein kinase kinase kinase kinase 2
  • Rab8 interacting protein
  • Rab8-interacting protein
  • RAB8IPMEKKK 2

Background

MAP4K2 is a member of the serine/threonine protein kinase family. Although this kinase is found in many tissues, its expression in lymphoid follicles is restricted to the cells of germinal centre, where it may participate in B-cell differentiation. This kinase can be activated by TNF-alpha, and has been shown to specifically activate MAP kinases. This kinase is also found to interact with TNF receptor-associated factor 2 (TRAF2), which is involved in the activation of MAP3K1/MEKK1.The protein encoded by this gene is a member of the serine/threonine protein kinase family. Although this kinase is found in many tissues, its expression in lymphoid follicles is restricted to the cells of germinal centre, where it may participate in B-cell differentiation. This kinase can be activated by TNF-alpha, and has been shown to specifically activate MAP kinases. This kinase is also found to interact with TNF receptor-associated factor 2 (TRAF2), which is involved in the activation of MAP3K1/MEKK1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P
NBP1-89679
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38243
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-76944
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59320
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC
NBP2-03396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89680
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-22218
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF2419
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP1-83385
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NLS932
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-80533
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB
NBP2-16679
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-87833
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00004760-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-58851
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Ze
Applications: WB

Publications for MAP4K2 Antibody (NBP1-58851) (0)

There are no publications for MAP4K2 Antibody (NBP1-58851).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAP4K2 Antibody (NBP1-58851) (0)

There are no reviews for MAP4K2 Antibody (NBP1-58851). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAP4K2 Antibody (NBP1-58851) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MAP4K2 Products

Bioinformatics Tool for MAP4K2 Antibody (NBP1-58851)

Discover related pathways, diseases and genes to MAP4K2 Antibody (NBP1-58851). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAP4K2 Antibody (NBP1-58851)

Discover more about diseases related to MAP4K2 Antibody (NBP1-58851).
 

Pathways for MAP4K2 Antibody (NBP1-58851)

View related products by pathway.

Research Areas for MAP4K2 Antibody (NBP1-58851)

Find related products by research area.

Blogs on MAP4K2

There are no specific blogs for MAP4K2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAP4K2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAP4K2
Uniprot