MAP4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MAP4 Antibody [NBP1-85874] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane, cytosol & microtubules.
Immunohistochemistry-Paraffin: MAP4 Antibody [NBP1-85874] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAP4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PPAQALEIMMGLKTTDMAPSKETEMALAKDMALATKTEVALAKDMESPTKLDVTLAKDMQPSMESDMALVKDMELPTEKEVALVKDVRWPTETDVSSAKNVV
Marker
Microtubule Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAP4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MAP4 Protein (NBP1-85874PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MAP4 Antibody

  • DKFZp779A1753
  • MAP-4
  • MGC8617
  • microtubule-associated protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-213
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
AF3795
Species: Hu
Applications: WB, IP
NBP1-76798
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33409
Species: Hu
Applications: WB, ICC/IF
NBP1-78028
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, ICC/IF
AF7387
Species: Hu
Applications: Flow, IHC, CyTOF-ready
MAB5277
Species: Hu
Applications: WB, IHC
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
NB300-124
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15412
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89575
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for MAP4 Antibody (NBP1-85874) (0)

There are no publications for MAP4 Antibody (NBP1-85874).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAP4 Antibody (NBP1-85874) (0)

There are no reviews for MAP4 Antibody (NBP1-85874). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MAP4 Antibody (NBP1-85874) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAP4 Products

Bioinformatics Tool for MAP4 Antibody (NBP1-85874)

Discover related pathways, diseases and genes to MAP4 Antibody (NBP1-85874). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAP4 Antibody (NBP1-85874)

Discover more about diseases related to MAP4 Antibody (NBP1-85874).
 

Pathways for MAP4 Antibody (NBP1-85874)

View related products by pathway.

PTMs for MAP4 Antibody (NBP1-85874)

Learn more about PTMs related to MAP4 Antibody (NBP1-85874).
 

Research Areas for MAP4 Antibody (NBP1-85874)

Find related products by research area.

Blogs on MAP4

There are no specific blogs for MAP4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAP4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAP4