MAO-A Antibody

Images

 
Western Blot: MAO-A Antibody [NBP1-54711] - Human Lung lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Rt, Mu, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAO-A Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human MAOA (NP_000231). Peptide sequence GPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIA. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Bovine (100%), Guinea Pig (100%), Rabbit (100%), Canine (100%), Equine (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAOA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against MAOA and was validated on Western blot.
Theoretical MW
60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using
NBP1-54711 in the following applications:

  • WB
    1 publication

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 25034165).

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MAO-A Antibody

  • amine oxidase [flavin-containing] A
  • EC 1.4.3
  • EC 1.4.3.4
  • MAOA
  • MAO-A
  • monoamine oxidase A
  • Monoamine oxidase type A

Background

MAOA catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOA preferentially oxidizes biogenic amines such as 5-hydroxytryptamine (5-HT), norepinephrine and epinephrine.This gene encodes monoamine oxidase A, an enzyme that degrades amine neurotransmitters, such as dopamine, norepinephrine, and serotonin. The protein localizes to the mitochondrial outer membrane. The gene is adjacent to a related gene on the opposite strand of chromosome X. Mutation in this gene results in monoamine oxidase deficiency, or Brunner syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87493
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-41387
Species: Hu
Applications: WB, ELISA, EIA, IHC, IHC-P, PEP-ELISA, S-ELISA
NB100-1892
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
NBP1-89671
Species: Hu, Eq
Applications: WB, IHC, IHC-P
NBP2-22164
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC, IHC-FrFl, IHC-WhMt, KO
NBP2-92717
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-86922
Species: Hu
Applications: WB, IHC, IHC-P
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, PA, B/N, KD
NLS1403
Species: Hu
Applications: IHC, IHC-P
NBP1-31386
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-74510
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-88361
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
NB100-182
Species: Hu, Mu, Rt, Av, Ca, Ma, Pm, Ze
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-P, IP, RNAi, KD, KO
NBP2-26091
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-21590
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
H00006999-B01P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54711
Species: Hu, Rt, Mu, Bv, Ca, Eq, Gp, Rb
Applications: WB

Publications for MAO-A Antibody (NBP1-54711)(1)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Rat
(1)
All Species

Reviews for MAO-A Antibody (NBP1-54711) (0)

There are no reviews for MAO-A Antibody (NBP1-54711). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAO-A Antibody (NBP1-54711). (Showing 1 - 1 of 1 FAQ).

  1. I want to know the published papers about NBP1-54711, I am finding a antibody like NBP1-54711.
    • We are currently not aware of any publications using this antibody, however our website is updated regularly with new information.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MAO-A Products

Bioinformatics Tool for MAO-A Antibody (NBP1-54711)

Discover related pathways, diseases and genes to MAO-A Antibody (NBP1-54711). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAO-A Antibody (NBP1-54711)

Discover more about diseases related to MAO-A Antibody (NBP1-54711).
 

Pathways for MAO-A Antibody (NBP1-54711)

View related products by pathway.

PTMs for MAO-A Antibody (NBP1-54711)

Learn more about PTMs related to MAO-A Antibody (NBP1-54711).

Blogs on MAO-A

There are no specific blogs for MAO-A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAO-A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAOA
Entrez
Uniprot