MANBA Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: MANBA Antibody [NBP2-47384] - Staining human cell line A549 shows positivity in vesicles. Antibody staining is shown i green.

Immunohistochemistry-Paraffin: MANBA Antibody [NBP2-47384] - Staining of human prostate shows strong cytoplasmic positivity, with a granular pattern in glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MANBA Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LSPTNYHFLSSPKEAVGLCKAQITAIISQQGDIFVFDLETSAVAPFVWLDVGSIPGRFSDNGFLMTEKTRTILFYPWEPTSKNELEQSFHVTS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MANBA
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MANBA Protein (NBP2-47384PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MANBA Antibody - BSA Free

• beta-mannosidase
• EC 3.2.1.25
• Lysosomal beta A mannosidase
• MANB1
• MANB1mannanase
• MANBA
• Mannanase
• Mannase
• mannosidase, beta A, lysosomal

Background

MANBA encodes a member of the glycosyl hydrolase 2 family. The encoded protein localizes to the lysosome where it is the final exoglycosidase in the pathway for N-linked glycoprotein oligosaccharide catabolism. Mutations in this gene are associated with beta-mannosidosis, a lysosomal storage disease that has a wide spectrum of neurological involvement.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MANBA