MAN2B1 Antibody

Images

 
Immunohistochemistry-Paraffin: MAN2B1 Antibody [NBP1-81326] - Staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.

Product Details

Summary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAN2B1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TGVLPNGYNPPRNLCWDVLCVDQPLVEDPRSPEYNAKELVDYFLNVATAQGRYYRTNHTVMTMGSDFQYENANMWFKNLDKLIRLVN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAN2B1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MAN2B1 Protein (NBP1-81326PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MAN2B1 Antibody

  • alpha B, lysosomal
  • EC 3.2.1
  • EC 3.2.1.24
  • LAMAN
  • Lysosomal acid alpha-mannosidase
  • MAN2B1
  • MANB
  • Mannosidase alpha class 2B member 1
  • Mannosidase Alpha-B
  • mannosidase, alpha, class 2B, member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP3-04803
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-02541
Species: Hu, Mu, Rt, Pm, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89748
Species: Hu
Applications: IHC, IHC-P
NBP1-87729
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02043
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-24716
Species: Hu, Mu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86072
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-87511
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27188
Species: Hu, Po, Ca, Pm
Applications: WB, Simple Western
NBP2-24653
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-32259
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
NBP1-89748
Species: Hu
Applications: IHC, IHC-P
NBP1-36953
Species: Hu
Applications: WB, PEP-ELISA

Publications for MAN2B1 Antibody (NBP1-81326) (0)

There are no publications for MAN2B1 Antibody (NBP1-81326).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAN2B1 Antibody (NBP1-81326) (0)

There are no reviews for MAN2B1 Antibody (NBP1-81326). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MAN2B1 Antibody (NBP1-81326) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MAN2B1 Products

Bioinformatics Tool for MAN2B1 Antibody (NBP1-81326)

Discover related pathways, diseases and genes to MAN2B1 Antibody (NBP1-81326). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAN2B1 Antibody (NBP1-81326)

Discover more about diseases related to MAN2B1 Antibody (NBP1-81326).
 

Pathways for MAN2B1 Antibody (NBP1-81326)

View related products by pathway.

Blogs on MAN2B1

There are no specific blogs for MAN2B1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAN2B1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAN2B1