MAK16 Antibody - BSA Free

Immunohistochemistry-Paraffin: MAK16 Antibody [NBP2-47385] - Staining of human thyroid gland shows strong nuclear positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MAK16 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QSDDVIWDTLGNKQFCSFKIRTKTQSFCRNEYSLTGLCNRSSCPLANSQYATIKEEKGQCYLYMKV
• Predicted Species: Mouse (97%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAK16
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MAK16 Protein (NBP2-47385PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MAK16 Antibody - BSA Free

• MAK16 homolog (S. cerevisiae)
• MAK16L
• NNP78
• protein MAK16 homolog
• Protein RBM13
• RBM13
• RNA binding motif protein 13
• RNA binding protein

Background

RBM13 (RNA-binding motif protein 13) is a member of the MAK16 (maintenance of killer protein 16) family of proteins. Despite its name, RBM13 has not been shown to be an RNA-binding protein, and the function of RBM13 is unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MAK16