RPL4 Antibody (4A3)

Images

 
Western Blot: RPL4 Antibody (4A3) [H00006124-M01] - RPL4 monoclonal antibody (M01), clone 4A3. Analysis of RPL4 expression in Raw 264.7.
Immunocytochemistry/ Immunofluorescence: RPL4 Antibody (4A3) [H00006124-M01] - Analysis of monoclonal antibody to RPL4 on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: RPL4 Antibody (4A3) [H00006124-M01] - RPL4 monoclonal antibody (M01), clone 4A3. Analysis of RPL4 expression in PC-12.
Western Blot: RPL4 Antibody (4A3) [H00006124-M01] - RPL4 monoclonal antibody (M01), clone 4A3 Analysis of RPL4 expression in K-562.
Sandwich ELISA: RPL4 Antibody (4A3) [H00006124-M01] - Detection limit for recombinant GST tagged RPL4 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, S-ELISA
Clone
4A3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RPL4 Antibody (4A3) Summary

Immunogen
RPL4 (NP_000959, 251 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IWTESAFRKLDELYGTWRKAASLKSNYNLPMHKMINTDLSRILKSPEIQRALRAPRKKIHRRVLKKNPLKNLRIMLKLNPYAKTMRRNTILRQARNHKLR
Specificity
RPL4 - ribosomal protein L4
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RPL4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Sandwich ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.
Publications
Read Publications using H00006124-M01.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RPL4 Antibody (4A3)

  • ribosomal protein L4,60S ribosomal protein L1,60S ribosomal protein L4
  • RPL1

Background

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L4E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31413
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20214
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00029956-M01A
Species: Hu, Mu
Applications: WB, ELISA, IHC
NBP1-83192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80104
Species: Hu
Applications: WB
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38323
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20216
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-76549
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-81328
Species: Hu
Applications: WB, ICC/IF
NBP1-06069
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB300-164
Species: Hu, Po, Ca, Pm, Rt(-)
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, Dual ISH-IHC
NBP2-94502
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-2269
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, KD
CD6
627-CD
Species: Hu
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
H00006124-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA

Publications for RPL4 Antibody (H00006124-M01)(2)

Reviews for RPL4 Antibody (H00006124-M01) (0)

There are no reviews for RPL4 Antibody (H00006124-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RPL4 Antibody (H00006124-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RPL4 Products

Bioinformatics Tool for RPL4 Antibody (H00006124-M01)

Discover related pathways, diseases and genes to RPL4 Antibody (H00006124-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPL4 Antibody (H00006124-M01)

Discover more about diseases related to RPL4 Antibody (H00006124-M01).
 

Pathways for RPL4 Antibody (H00006124-M01)

View related products by pathway.

Blogs on RPL4

There are no specific blogs for RPL4, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPL4 Antibody (4A3) and receive a gift card or discount.

Bioinformatics

Gene Symbol RPL4
Entrez
OMIM
Uniprot