MAK Antibody

Images

 
Western Blot: MAK Antibody [NBP1-54991] - Titration: 1 ug/ml Positive Control: Human pancreatic cancer cell line MiaPaca-2 and Panc-1.
Immunocytochemistry/ Immunofluorescence: MAK Antibody [NBP1-54991] - Human lung adenocarcinoma cell line A549, 25.
Western Blot: MAK Antibody [NBP1-54991] - Hela cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAK Antibody Summary

Immunogen
Synthetic peptides corresponding to MAK(male germ cell-associated kinase) The peptide sequence was selected from the C terminal of MAK. Peptide sequence WNTKTGRGQFSGRTYNPTAKNLNIVNRAQPIPSVHGRTDWVAKYGGHR.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:2000
  • Immunohistochemistry 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against MAK and was validated on Western blot.
Theoretical MW
70 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MAK Antibody

  • dJ417M14.2
  • EC 2.7.11
  • EC 2.7.11.22
  • male germ cell-associated kinaseserine/threonine protein kinase MAK
  • serine/threonine-protein kinase MAK

Background

MAK is a serine/threonine protein kinase related to kinases involved in cell cycle regulation. It is expressed almost exclusively in the testis, primarily in germ cells. Studies of the mouse and rat homologs have localized the kinase to the chromosomes during meiosis in spermatogenesis, specifically to the synaptonemal complex that exists while homologous chromosomes are paired. There is, however, a study of the mouse homolog that has identified high levels of expression in developing sensory epithelia so its function may be more generalized.The product of this gene is a serine/threonine protein kinase related to kinases involved in cell cycle regulation. It is expressed almost exclusively in the testis, primarily in germ cells. Studies of the mouse and rat homologs have localized the kinase to the chromosomes during meiosis in spermatogenesis, specifically to the synaptonemal complex that exists while homologous chromosomes are paired. There is, however, a study of the mouse homolog that has identified high levels of expression in developing sensory epithelia so its function may be more generalized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56618
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-23656
Species: Hu, Bv, Pm
Applications: WB
NBP2-14344
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-67811
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF262
Species: Hu
Applications: WB, IHC, ICC, Neut
NBP1-90367
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
27550002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-54991
Species: Hu
Applications: WB, ICC/IF, IHC

Publications for MAK Antibody (NBP1-54991) (0)

There are no publications for MAK Antibody (NBP1-54991).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAK Antibody (NBP1-54991) (0)

There are no reviews for MAK Antibody (NBP1-54991). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MAK Antibody (NBP1-54991) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for MAK Antibody (NBP1-54991)

Discover related pathways, diseases and genes to MAK Antibody (NBP1-54991). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAK Antibody (NBP1-54991)

Discover more about diseases related to MAK Antibody (NBP1-54991).
 

Pathways for MAK Antibody (NBP1-54991)

View related products by pathway.

PTMs for MAK Antibody (NBP1-54991)

Learn more about PTMs related to MAK Antibody (NBP1-54991).
 

Research Areas for MAK Antibody (NBP1-54991)

Find related products by research area.

Blogs on MAK

There are no specific blogs for MAK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAK Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAK
Uniprot