MAGP-2/MFAP5 Antibody

Images

 
Western Blot: MAGP-2/MFAP5 Antibody [H00008076-B01P] - Analysis of MFAP5 expression in transfected 293T cell line by MFAP5 polyclonal antibody. Lane 1: MFAP5 transfected lysate(19.03 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MAGP-2/MFAP5 Antibody Summary

Immunogen
MFAP5 (NP_003471.1, 1 a.a. - 173 a.a.) full-length human protein. MSLLGPKVLLFLAAFIITSDWIPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL
Specificity
MFAP5 - microfibrillar associated protein 5,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
MFAP5
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MAGP-2/MFAP5 Antibody

  • MAGP2
  • MAGP-2
  • MAGP2MFAP-5
  • MFAP5
  • Microfibril-associated glycoprotein 2
  • microfibrillar associated protein 5
  • microfibrillar-associated protein 5
  • MP25
  • MP25microfibril-associated glycoprotein-2

Background

This gene encodes a 25-kD microfibril-associated glycoprotein which is rich in serine and threonine residues. It lacks a hydrophobic carboxyl terminus and proline-, glutamine-, and tyrosine-rich regions, which are characteristics of a related 31-kDa microfibril-associated glycoprotein (MFAP2). The close similarity between these two proteins is confined to a central region of 60 aa where precise alignment of 7 cysteine residues occurs. The structural differences suggest that this encoded protein has some functions that are distinct from those of MFAP2. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4977
Species: Mu
Applications: WB
NB110-8146
Species: Hu, Po, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IM
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
AF143
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-88169
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, ISH
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-33479
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-87959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84725
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-58529
Species: Hu
Applications: ICC/IF
AF2846
Species: Hu
Applications: WB, IHC
H00008209-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-13382
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31368
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00008076-B01P
Species: Hu
Applications: WB

Publications for MAGP-2/MFAP5 Antibody (H00008076-B01P) (0)

There are no publications for MAGP-2/MFAP5 Antibody (H00008076-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAGP-2/MFAP5 Antibody (H00008076-B01P) (0)

There are no reviews for MAGP-2/MFAP5 Antibody (H00008076-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAGP-2/MFAP5 Antibody (H00008076-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAGP-2/MFAP5 Products

Bioinformatics Tool for MAGP-2/MFAP5 Antibody (H00008076-B01P)

Discover related pathways, diseases and genes to MAGP-2/MFAP5 Antibody (H00008076-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAGP-2/MFAP5 Antibody (H00008076-B01P)

Discover more about diseases related to MAGP-2/MFAP5 Antibody (H00008076-B01P).
 

Pathways for MAGP-2/MFAP5 Antibody (H00008076-B01P)

View related products by pathway.

Blogs on MAGP-2/MFAP5

There are no specific blogs for MAGP-2/MFAP5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAGP-2/MFAP5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MFAP5
Entrez
Uniprot