ARS2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ARS2 Antibody [NBP2-13382] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry: ARS2 Antibody [NBP2-13382] - Immunohistochemical staining of human colon shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARS2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TCSLFMRNIAPNISRAEIISLCKRYPGFMRVALSEPQPERRFFRRGWVTF DRSVNIKEICWNLQNIRLRECELSPGVNRDLTRRVRNINGITQHKQI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SRRT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ARS2 Protein (NBP2-13382PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARS2 Antibody

  • ARS2serrate
  • arsenate resistance protein 2
  • arsenate resistance protein ARS2
  • arsenite resistance protein
  • Arsenite-resistance protein 2
  • ASR2
  • MGC126427
  • serrate RNA effector molecule homolog (Arabidopsis)
  • serrate RNA effector molecule homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27101
Species: Hu, Pm
Applications: WB
NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
AF745
Species: Mu
Applications: WB, Block
NBP1-80775
Species: Hu
Applications: IHC, IHC-P
NBP2-32001
Species: Hu, Mu
Applications: IHC, IHC-P
AF1620
Species: Mu
Applications: WB, IHC
AF5800
Species: Mu, Rt
Applications: WB, IHC
AF1726
Species: Hu
Applications: WB, IHC, ICC
NBP2-13351
Species: Hu, ChHa
Applications: WB, IHC, IHC-P
MAB8634
Species: Mu
Applications: WB, Simple Western, Flow, IHC
NB100-93551
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1190
Species: Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
NBP2-45478
Species: Hu, Mu, Rt, Mk
Applications: WB, IHC
AF6367
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-2817
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
AF4079
Species: Hu
Applications: WB, ICC
NBP2-39097
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13382
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ARS2 Antibody (NBP2-13382) (0)

There are no publications for ARS2 Antibody (NBP2-13382).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARS2 Antibody (NBP2-13382) (0)

There are no reviews for ARS2 Antibody (NBP2-13382). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ARS2 Antibody (NBP2-13382) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARS2 Products

Bioinformatics Tool for ARS2 Antibody (NBP2-13382)

Discover related pathways, diseases and genes to ARS2 Antibody (NBP2-13382). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARS2 Antibody (NBP2-13382)

Discover more about diseases related to ARS2 Antibody (NBP2-13382).
 

Pathways for ARS2 Antibody (NBP2-13382)

View related products by pathway.

PTMs for ARS2 Antibody (NBP2-13382)

Learn more about PTMs related to ARS2 Antibody (NBP2-13382).

Blogs on ARS2

There are no specific blogs for ARS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARS2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SRRT
Entrez
Uniprot