MAdCAM-1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: YHLWKRCRHLAEDDTHPPASLRLLPQVSAWAGLRGTGQVGIS |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MADCAM1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin
|
| Application Notes |
For use with IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for MAdCAM-1 Antibody - BSA Free
Background
Mucosal vascular addressin-1 (MAdCAM-1) is a type I transmembrane glycoprotein expressed at high levels on high endothelial venules (HEV) of Peyer's patches and mesenteric lymph nodes, and on flat walled venules within the gut lamina propria. It is also expressed on sinus-lining cells in the spleen. (1-3) The countereceptor or "homing receptor" for MAdCAM-1 is alpha4beta7 integrin (also known as LPAM-1). MAdCAM-1 is also a facultative ligand for CD62L/L-selectin. (4, 5) The monoclonal antibody MECA-367 binds to the first domain of MAdCAM-1 and blocks MAdCAM-1-dependent binding in vitro and lymphocyte homing to Peyer's patch HEV in vivo. (1, 2, 4)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Mu
Applications: AdBlk, IHC, WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, WB
Species: Mu
Applications: ELISA
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
Species: Hu
Applications: CyTOF-ready, Flow, IP
Species: Hu
Applications: AdBlk
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Mu
Applications: BA
Species: Hu
Applications: BA
Publications for MAdCAM-1 Antibody (NBP3-18862) (0)
There are no publications for MAdCAM-1 Antibody (NBP3-18862).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MAdCAM-1 Antibody (NBP3-18862) (0)
There are no reviews for MAdCAM-1 Antibody (NBP3-18862).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for MAdCAM-1 Antibody (NBP3-18862) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MAdCAM-1 Products
Blogs on MAdCAM-1