MAdCAM-1 Antibody - BSA Free

Immunohistochemistry-Paraffin: MAdCAM-1 Antibody [NBP3-18862] - Staining of human appendix shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MAdCAM-1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MAdCAM-1 Antibody - BSA Free (NBP3-18862) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YHLWKRCRHLAEDDTHPPASLRLLPQVSAWAGLRGTGQVGIS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MADCAM1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
• Application Notes: For use with IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MAdCAM-1 Antibody - BSA Free

• hMAdCAM-1
• MACAM1
• MAdCAM1
• MAdCAM-1
• mucosal addressin cell adhesion molecule 1
• mucosal addressin cell adhesion molecule-1
• mucosal vascular addressin cell adhesion molecule 1

Background

Mucosal vascular addressin-1 (MAdCAM-1) is a type I transmembrane glycoprotein expressed at high levels on high endothelial venules (HEV) of Peyer's patches and mesenteric lymph nodes, and on flat walled venules within the gut lamina propria. It is also expressed on sinus-lining cells in the spleen. (1-3) The countereceptor or "homing receptor" for MAdCAM-1 is alpha4beta7 integrin (also known as LPAM-1). MAdCAM-1 is also a facultative ligand for CD62L/L-selectin. (4, 5) The monoclonal antibody MECA-367 binds to the first domain of MAdCAM-1 and blocks MAdCAM-1-dependent binding in vitro and lymphocyte homing to Peyer's patch HEV in vivo. (1, 2, 4)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MADCAM1