LYZL2 Antibody

Images

 
Western Blot: LYZL2 Antibody [H00119180-B01P] - Analysis of LYZL2 expression in transfected 293T cell line by LYZL2 polyclonal antibody. Lane 1: LYZL2 transfected lysate(21.34 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

LYZL2 Antibody Summary

Immunogen
LYZL2 (NP_898881.2, 1 a.a. - 194 a.a.) full-length human protein. MQDAPLSCLSPTKWSSVSSADSTEKSASAAGTRNLPFQFCLRQALRMKAAGILTLIGCLVTGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQTVLDDGSIDYGIFQINSFAWCRRGKLKENNHCHVACSALVTDDLTDAIICAKKIVKETQGMNYWQGWKKHCEGRDLSDWKKDCEVS
Specificity
LYZL2,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
LYZL2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
Application Notes
This antibody is useful for ELISA and Western Blot.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LYZL2 Antibody

  • EC 3.2.1.17
  • lysozyme 2
  • lysozyme-2
  • lysozyme-like 2
  • lysozyme-like protein 2

Background

Lysozymes (see LYZ; MIM 153450), especially C-type lysozymes, are well-recognized bacteriolytic factors widely distributed in the animal kingdom and play a mainly protective role in host defense. LYZL2 is a member of a family of lysozyme-like genes (Zhang et al., 2005 [PubMed 16014814]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33518
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89136
Species: Hu
Applications: WB, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-81029
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF756
Species: Mu
Applications: WB, IHC
NB600-836
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-92164
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3049
Species: Hu
Applications: WB, IHC
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-02984
Species: Hu, Mu, Rt, Ca, Pm, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-85385
Species: Hu, Mu
Applications: WB
NBP3-06363
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB2029
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-81279
Species: Hu
Applications: WB, IHC, IHC-P
AF7970
Species: Mu
Applications: WB
NB100-2475
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA
AF5788
Species: Hu, Mu, Rt
Applications: WB, IHC, ICC
NB100-615
Species: Hu, Mu, Rt, Sh
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-88809
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00119180-B01P
Species: Hu
Applications: WB

Publications for LYZL2 Antibody (H00119180-B01P) (0)

There are no publications for LYZL2 Antibody (H00119180-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LYZL2 Antibody (H00119180-B01P) (0)

There are no reviews for LYZL2 Antibody (H00119180-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LYZL2 Antibody (H00119180-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LYZL2 Products

Bioinformatics Tool for LYZL2 Antibody (H00119180-B01P)

Discover related pathways, diseases and genes to LYZL2 Antibody (H00119180-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LYZL2 Antibody (H00119180-B01P)

Discover more about diseases related to LYZL2 Antibody (H00119180-B01P).

Blogs on LYZL2

There are no specific blogs for LYZL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LYZL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LYZL2
Entrez
Uniprot