Lymphotoxin beta R/TNFRSF3 Recombinant Protein Antigen

Images

 
There are currently no images for Lymphotoxin beta R/TNFRSF3 Recombinant Protein Antigen (NBP2-68777PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Lymphotoxin beta R/TNFRSF3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Lymphotoxin beta R/TNFRSF3.

Source: E. coli

Amino Acid Sequence: EAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LTBR
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-54678.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Lymphotoxin beta R/TNFRSF3 Recombinant Protein Antigen

  • CD18
  • D12S370
  • ltbetar
  • LT-BETA-R
  • LTBR
  • lymphotoxin B receptor
  • Lymphotoxin beta R
  • lymphotoxin beta receptor (TNFR superfamily, member 3)
  • Lymphotoxin-beta receptor
  • LymphotoxinbR
  • TNF RIII
  • TNF Rrp
  • TNFCRTNF-RIII
  • TNFR superfamily, member 3
  • TNFR2-RP
  • TNFR3
  • TNF-R-III
  • TNFR-RP
  • TNFRSF3
  • TNFRSF3TNFR-III
  • Tumor necrosis factor C receptor
  • Tumor necrosis factor receptor 2-related protein
  • tumor necrosis factor receptor superfamily member 3
  • tumor necrosis factor receptor superfamily, member 3
  • Tumor necrosis factor receptor type III

Background

LT-beta-R, also known as lymphotoxin beta receptor and tumor necrosis factor receptor superfamily member 3 is a 47 kD transmembrane protein containing 3 TNF receptor domains. The LT-beta-R is a receptor for the heterotrimeric lymphotoxin complex (composed of LT alpha and LT beta as well as LIGHT. LT-beta-R is highly expressed in the lung, liver, and kidney and moderately expressed expressed in the heart and testes. LT-beta-R is weakly expressed in the brain, thymus, spleen, and lymph nodes. The cytoplasmic tail of LT-beta-R interacts with TRAF3, TRAF4, and TRAF5 as well as the hepatitis C virus core protein. Ligand binding to LT-beta-R has been shown to induce apoptosis (via TRAF3 and TRAF5) and play a role in the development of lymphoid organs.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-89474
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Simple Western, Single-Cell Western, WB
NB500-328
Species: Hu
Applications: CyTOF-ready, Flow, IP
796-IC
Species: Mu
Applications: BA
210-TA
Species: Hu
Applications: BA
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
AF1730
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
728-LS
Species: Hu
Applications: BA
NB110-97871
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
D6050
Species: Hu
Applications: ELISA
DC140
Species: Hu
Applications: ELISA
NBP2-93743
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
MAB17781
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
202-IL
Species: Hu
Applications: BA
MAB208
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
BBA16
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, WB
AF3667
Species: Hu, Mu
Applications: ICC, IHC, Simple Western, WB

Publications for Lymphotoxin beta R/TNFRSF3 Recombinant Protein Antigen (NBP2-68777PEP) (0)

There are no publications for Lymphotoxin beta R/TNFRSF3 Recombinant Protein Antigen (NBP2-68777PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lymphotoxin beta R/TNFRSF3 Recombinant Protein Antigen (NBP2-68777PEP) (0)

There are no reviews for Lymphotoxin beta R/TNFRSF3 Recombinant Protein Antigen (NBP2-68777PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Lymphotoxin beta R/TNFRSF3 Recombinant Protein Antigen (NBP2-68777PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Lymphotoxin beta R/TNFRSF3 Products

Bioinformatics Tool for Lymphotoxin beta R/TNFRSF3 Recombinant Protein Antigen (NBP2-68777PEP)

Discover related pathways, diseases and genes to Lymphotoxin beta R/TNFRSF3 Recombinant Protein Antigen (NBP2-68777PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Lymphotoxin beta R/TNFRSF3 Recombinant Protein Antigen (NBP2-68777PEP)

Discover more about diseases related to Lymphotoxin beta R/TNFRSF3 Recombinant Protein Antigen (NBP2-68777PEP).
 

Pathways for Lymphotoxin beta R/TNFRSF3 Recombinant Protein Antigen (NBP2-68777PEP)

View related products by pathway.

PTMs for Lymphotoxin beta R/TNFRSF3 Recombinant Protein Antigen (NBP2-68777PEP)

Learn more about PTMs related to Lymphotoxin beta R/TNFRSF3 Recombinant Protein Antigen (NBP2-68777PEP).
 

Research Areas for Lymphotoxin beta R/TNFRSF3 Recombinant Protein Antigen (NBP2-68777PEP)

Find related products by research area.

Blogs on Lymphotoxin beta R/TNFRSF3

There are no specific blogs for Lymphotoxin beta R/TNFRSF3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Lymphotoxin beta R/TNFRSF3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LTBR