Lymphotoxin beta R/TNFRSF3 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Lymphotoxin beta R/TNFRSF3 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Lymphotoxin beta R/TNFRSF3.
  
  

  Source: E. coli

  Amino Acid Sequence: EAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGT

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: LTBR
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68777.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Lymphotoxin beta R/TNFRSF3 Recombinant Protein Antigen

• CD18
• D12S370
• ltbetar
• LT-BETA-R
• LTBR
• lymphotoxin B receptor
• Lymphotoxin beta R
• lymphotoxin beta receptor (TNFR superfamily, member 3)
• Lymphotoxin-beta receptor
• LymphotoxinbR
• TNF RIII
• TNF Rrp
• TNFCRTNF-RIII
• TNFR superfamily, member 3
• TNFR2-RP
• TNFR3
• TNF-R-III
• TNFR-RP
• TNFRSF3
• TNFRSF3TNFR-III
• Tumor necrosis factor C receptor
• Tumor necrosis factor receptor 2-related protein
• tumor necrosis factor receptor superfamily member 3
• tumor necrosis factor receptor superfamily, member 3
• Tumor necrosis factor receptor type III

Background

LT-beta-R, also known as lymphotoxin beta receptor and tumor necrosis factor receptor superfamily member 3 is a 47 kD transmembrane protein containing 3 TNF receptor domains. The LT-beta-R is a receptor for the heterotrimeric lymphotoxin complex (composed of LT alpha and LT beta as well as LIGHT. LT-beta-R is highly expressed in the lung, liver, and kidney and moderately expressed expressed in the heart and testes. LT-beta-R is weakly expressed in the brain, thymus, spleen, and lymph nodes. The cytoplasmic tail of LT-beta-R interacts with TRAF3, TRAF4, and TRAF5 as well as the hepatitis C virus core protein. Ligand binding to LT-beta-R has been shown to induce apoptosis (via TRAF3 and TRAF5) and play a role in the development of lymphoid organs.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: LTBR