Lymphotoxin beta R/TNFRSF3 Antibody

Images

 
Western Blot: Lymphotoxin beta R/TNFRSF3 Antibody [H00004055-B02P] - Analysis of LTBR expression in transfected 293T cell line by LTBR polyclonal antibody. Lane 1: LTBR transfected lysate(46.70 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Lymphotoxin beta R/TNFRSF3 Antibody Summary

Immunogen
LTBR (NP_002333.1, 1 a.a. - 435 a.a.) full-length human protein. MLLPWATSAPGLAWGPLVLGLFGLLAASQPQAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLMLAVLLPLAFFLLLATVFSCIWKSHPSLCRKLGSLLKRRPQGEGPNPVAGSWEPPKAHPYFPDLVQPLLPISGDVSPVSTGLPAAPVLEAGVPQQQSPLDLTREPQLEPGEQSQVAHGTNGIHVTGGSMTITGNIYIYNGPVLGGPPGPGDLPATPEPPYPIPEEGDPGPPGLSTPHQEDGKAWHLAETEHCGATPSNRGPRNQFITHD
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
LTBR
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Lymphotoxin beta R/TNFRSF3 Antibody

  • CD18
  • D12S370
  • ltbetar
  • LT-BETA-R
  • LTBR
  • lymphotoxin B receptor
  • Lymphotoxin beta R
  • lymphotoxin beta receptor (TNFR superfamily, member 3)
  • Lymphotoxin-beta receptor
  • LymphotoxinbR
  • TNF RIII
  • TNF Rrp
  • TNFCRTNF-RIII
  • TNFR superfamily, member 3
  • TNFR2-RP
  • TNFR3
  • TNF-R-III
  • TNFR-RP
  • TNFRSF3
  • TNFRSF3TNFR-III
  • Tumor necrosis factor C receptor
  • Tumor necrosis factor receptor 2-related protein
  • tumor necrosis factor receptor superfamily member 3
  • tumor necrosis factor receptor superfamily, member 3
  • Tumor necrosis factor receptor type III

Background

The protein encoded by this gene is a member of the tumor necrosis factor (TNF) family of receptors. It is expressed on the surface of most cell types, including cells of epithelial and myeloid lineages, but not on T and B lymphocytes. The protein specifically binds the lymphotoxin membrane form (a complex of lymphotoxin-alpha and lymphtoxin-beta). The encoded protein and its ligand play a role in the development and organization of lymphoid tissue and tranformed cells. Activation of the encoded protein can trigger apoptosis. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB500-328
Species: Hu
Applications: Flow, IP, CyTOF-ready
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
NBP1-42795
Species: Hu
Applications: WB, Flow, Func, IHC, IHC-Fr, IP, CyTOF-ready
NB110-97871
Species: Mu
Applications: Flow, IHC, IHC-P, IP, CyTOF-ready
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-36561
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC

Publications for Lymphotoxin beta R/TNFRSF3 Antibody (H00004055-B02P) (0)

There are no publications for Lymphotoxin beta R/TNFRSF3 Antibody (H00004055-B02P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lymphotoxin beta R/TNFRSF3 Antibody (H00004055-B02P) (0)

There are no reviews for Lymphotoxin beta R/TNFRSF3 Antibody (H00004055-B02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Lymphotoxin beta R/TNFRSF3 Antibody (H00004055-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Lymphotoxin beta R/TNFRSF3 Products

Bioinformatics Tool for Lymphotoxin beta R/TNFRSF3 Antibody (H00004055-B02P)

Discover related pathways, diseases and genes to Lymphotoxin beta R/TNFRSF3 Antibody (H00004055-B02P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Lymphotoxin beta R/TNFRSF3 Antibody (H00004055-B02P)

Discover more about diseases related to Lymphotoxin beta R/TNFRSF3 Antibody (H00004055-B02P).
 

Pathways for Lymphotoxin beta R/TNFRSF3 Antibody (H00004055-B02P)

View related products by pathway.

PTMs for Lymphotoxin beta R/TNFRSF3 Antibody (H00004055-B02P)

Learn more about PTMs related to Lymphotoxin beta R/TNFRSF3 Antibody (H00004055-B02P).
 

Research Areas for Lymphotoxin beta R/TNFRSF3 Antibody (H00004055-B02P)

Find related products by research area.

Blogs on Lymphotoxin beta R/TNFRSF3

There are no specific blogs for Lymphotoxin beta R/TNFRSF3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Lymphotoxin beta R/TNFRSF3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LTBR
Entrez
Uniprot