LYAR Antibody - BSA Free

Immunohistochemistry-Paraffin: LYAR Antibody [NBP1-86827] - Staining in human testis and fallopian tube tissues using anti-LYAR antibody. Corresponding LYAR RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: LYAR Antibody [NBP1-86827] - Staining of human cell line A-431 shows localization to nucleus & nucleoli. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: LYAR Antibody [NBP1-86827] - Staining of human rectum shows no positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: LYAR Antibody [NBP1-86827] - Staining of human fallopian tube shows low expression as expected.

Immunohistochemistry-Paraffin: LYAR Antibody [NBP1-86827] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: LYAR Antibody [NBP1-86827] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.

• Reactivity: Hu, Mu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LYAR Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit LYAR Antibody - BSA Free (NBP1-86827) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-LYAR Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RELLEQISAFDNVPRKKAKFQNWMKNSLKVHNESILDQVWNIFSEASNSEPVNKEQDQRPLHPVANPHAEISTKVPASKVKDAVEQQGEVKKNKRERKEER
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LYAR
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  LYAR Protein (NBP1-86827PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261). Mouse reactivity reported in scientific literature (PMID: 22815056).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for LYAR Antibody - BSA Free

• cell growth-regulating nucleolar protein
• FLJ20425
• Ly1 reactive homolog (mouse)
• LYAR
• PNAS-5
• ZLYAR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LYAR Antibody (NBP1-86827)(3)

Publications using NBP1-86827

• Miao H, Zhang Y, Liu C et al. Upregulation of Long Noncoding RNA Meg3 Induced by DNA Hypomethylation Maintains Stemness and Pluripotency of Mouse Embryonic Stem Cells in Folate Supplementation via Stabilization of LYAR Lancet 2019-06-23
• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]
• Wang G, Fulkerson CM, Malek R et al. Mutations in Lyar and p53 are synergistically lethal in female mice Birth Defects Res A Clin Mol Teratol 2012-07-19 [PMID: 22815056] (WB, Mouse)

Bioinformatics

• Gene Symbol: LYAR