LYAR Antibody

Images

 
Western Blot: LYAR Antibody [NBP1-86827] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: LYAR Antibody [NBP1-86827] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: LYAR Antibody [NBP1-86827] - Staining of human testis shows strong nuclear positivity in subsets of cells in seminiferus ducts.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LYAR Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RELLEQISAFDNVPRKKAKFQNWMKNSLKVHNESILDQVWNIFSEASNSEPVNKEQDQRPLHPVANPHAEISTKVPASKVKDAVEQQGEVKKNKRERKEER
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LYAR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LYAR Protein (NBP1-86827PEP)
Publications
Read Publications using
NBP1-86827 in the following applications:

  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261). Mouse reactivity reported in scientific literature (PMID: 22815056).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LYAR Antibody

  • cell growth-regulating nucleolar protein
  • FLJ20425
  • Ly1 reactive homolog (mouse)
  • LYAR
  • PNAS-5
  • ZLYAR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02690
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-37384
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NB100-236
Species: Hu, Mu
Applications: WB, IB, IHC, IHC-Fr, IHC-P, IP
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-35006
Species: Hu
NBP2-37585
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB600-1342
Species: Hu, Mu, Rt, Bv
Applications: WB, Func, IA, IHC, IHC-Fr, IHC-P, IP
H00388112-B01P
Species: Hu
Applications: WB, ELISA
AF1997
Species: Hu
Applications: WB, ChIP, ICC
NBP2-24750
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P
NB600-241
Species: Hu, Mu, Rt, Pl
Applications: WB, Simple Western, ChIP, EM, ICC/IF, IHC, IHC-P, IM
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
AF7565
Species: Hu, Mu, Rt
Applications: WB, IHC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for LYAR Antibody (NBP1-86827)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for LYAR Antibody (NBP1-86827) (0)

There are no reviews for LYAR Antibody (NBP1-86827). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LYAR Antibody (NBP1-86827) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LYAR Products

Bioinformatics Tool for LYAR Antibody (NBP1-86827)

Discover related pathways, diseases and genes to LYAR Antibody (NBP1-86827). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LYAR Antibody (NBP1-86827)

Discover more about diseases related to LYAR Antibody (NBP1-86827).
 

Pathways for LYAR Antibody (NBP1-86827)

View related products by pathway.

PTMs for LYAR Antibody (NBP1-86827)

Learn more about PTMs related to LYAR Antibody (NBP1-86827).
 

Research Areas for LYAR Antibody (NBP1-86827)

Find related products by research area.

Blogs on LYAR

There are no specific blogs for LYAR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LYAR Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LYAR
Entrez