LTK Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: LTK Antibody [NBP2-32475] - Immunofluorescent staining of human cell line RH-30 shows localization to vesicles.
Immunohistochemistry-Paraffin: LTK Antibody [NBP2-32475] - Staining of human tonsil shows moderate cytoplasmic positivity in subset of germinal center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LTK Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: TQDPDVLNSLLPMELGPTPEEEGTSGLGNRSLECLRPPQPQELSPEKLKSWGGSPLGPWLSSGLKPLKS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LTK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LTK Protein (NBP2-32475PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LTK Antibody

  • EC 2.7.10.1
  • leukocyte receptor tyrosine kinase
  • leukocyte tyrosine kinase receptor
  • leukocyte tyrosine kinase
  • LTK
  • TYK1
  • TYK1Protein tyrosine kinase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33891
Species: Hu
Applications: IHC, IHC-P
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-26380
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF4210
Species: Hu
Applications: WB, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-22164
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-32530
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87441
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
AF3978
Species: Hu, Mu, Rt
Applications: WB, IHC
NB300-188
Species: Rt
Applications: IHC, IHC-P
H00006464-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, PLA
AF-258-PB
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-80775
Species: Hu
Applications: IHC, IHC-P
NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-32001
Species: Hu, Mu
Applications: IHC, IHC-P

Publications for LTK Antibody (NBP2-32475) (0)

There are no publications for LTK Antibody (NBP2-32475).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LTK Antibody (NBP2-32475) (0)

There are no reviews for LTK Antibody (NBP2-32475). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for LTK Antibody (NBP2-32475) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LTK Products

Bioinformatics Tool for LTK Antibody (NBP2-32475)

Discover related pathways, diseases and genes to LTK Antibody (NBP2-32475). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LTK Antibody (NBP2-32475)

Discover more about diseases related to LTK Antibody (NBP2-32475).
 

Pathways for LTK Antibody (NBP2-32475)

View related products by pathway.

PTMs for LTK Antibody (NBP2-32475)

Learn more about PTMs related to LTK Antibody (NBP2-32475).
 

Research Areas for LTK Antibody (NBP2-32475)

Find related products by research area.

Blogs on LTK

There are no specific blogs for LTK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LTK Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LTK
Entrez