ACCN1 Antibody

Images

 
Western Blot: ACCN1 Antibody [NBP2-14321] - Analysis in control (vector only transfected HEK293T lysate) and ASIC2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Orthogonal Strategies: Immunohistochemistry-Paraffin: ACCN1 Antibody [NBP2-14321] - Staining in human cerebral cortex and kidney tissues using anti-ASIC2 antibody. Corresponding ASIC2 RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: ACCN1 Antibody [NBP2-14321] - Staining of human hippocampus shows distinct positivity in neuropil along with subsets of neuronal cells.
Immunohistochemistry-Paraffin: ACCN1 Antibody [NBP2-14321] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: ACCN1 Antibody [NBP2-14321] - Staining of human kidney shows low expression as expected.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

ACCN1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: LLDVNLQIPDPHLADPSVLEALRQKANFKHYKPKQFSMLEFLHRVGHDLKDMMLYCKFKGQECGHQDFTTVFTKY
Predicted Species
Mouse (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ASIC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ACCN1 Protein (NBP2-14321PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACCN1 Antibody

  • Acid-sensing ion channel 2
  • Amiloride-sensitive brain sodium channel
  • amiloride-sensitive cation channel 1, neuronal
  • ASIC2a
  • ASIC2Mammalian degenerin homolog
  • BNAC1
  • BNaC1ACCN
  • BNC1Amiloride-sensitive cation channel neuronal 1
  • degenerin
  • hBNaC1
  • MDEGBrain sodium channel 1
  • neuronal amiloride-sensitive cation channel 1

Background

FUNCTION: Cation channel with high affinity for sodium, which is gated by extracellular protons and inhibited by the diuretic amiloride. Also permeable for Li(+) and K(+). Generates a biphasic current with a fast inactivating and a slow sustained phase. Heteromeric channel assembly seems to modulate.; SUBUNIT: Homotetramer or heterotetramer with other ASIC proteins. Interacts with STOM. Interacts with PRKCABP and ACCN3.; SUBCELLULAR LOCATION: Cell membrane; Multi-pass membrane protein. Note: Localized at the plasma membrane of neurons, in the soma and punctated peripheral processes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22409
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-46288
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB100-41403
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-15241
Species: Hu
Applications: WB
DBD00
Species: Hu
Applications: ELISA
NBP1-97417
Species: Hu, In, Mu, Pm, Rt
Applications: ICC/IF, IF, IHC (-), IHC, WB
NB120-2788
Species: Bv, Fe, Fi, Ha, Hu, Mu, Pm, Rt
Applications: B/N, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NBP1-69078
Species: Mu
Applications: WB
AF1056
Species: Rt
Applications: IHC, WB
688-TK
Species: Hu
Applications: BA
268-N4/CF
Species: Hu
Applications: BA
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB

Publications for ACCN1 Antibody (NBP2-14321) (0)

There are no publications for ACCN1 Antibody (NBP2-14321).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACCN1 Antibody (NBP2-14321) (0)

There are no reviews for ACCN1 Antibody (NBP2-14321). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACCN1 Antibody (NBP2-14321) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACCN1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ASIC2