LSP1 Antibody - BSA Free

Analysis in human tonsil and liver tissues Corresponding LSP1 RNA-seq data are presented for the same tissues.

Staining of human tonsil shows strong membranous positivity in non-germinal center cells.

Staining of human liver shows no positivity in hepatocytes as expected.

Staining of human cerebral cortex shows no positivity in neurons as expected.

Staining of human duodenum shows strong membranous positivity in lymphoid cells.

Staining of human lymph node shows strong membranous positivity in non-germinal center cells.

Analysis in human cell line HDLM-2.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LSP1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit LSP1 Antibody - BSA Free (NBP1-86852) is a polyclonal antibody validated for use in IHC and WB. Anti-LSP1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PRTPSPLVLEGTIEQSSPPLSPTTKLIDRTESLNRSIEKSNSVKKSQPDLPISKIDQWLEQYTQAIETAGRTPKLARQASIELPSMAVASTK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LSP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: IHC reported in scientific literature (PMID: 25674539). For IHC-Paraffin, HIER pH 6 retrieval is recommended. For
• Control Peptide:

  LSP1 Protein (NBP1-86852PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (82%). Human reactivity reported in scientific literature (PMID: 25674539).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for LSP1 Antibody - BSA Free

• 47 kDa actin binding protein
• 47 kDa actin-binding protein
• 52 kDa phosphoprotein
• F-actin binding and cytoskeleton associated protein
• leufactin (leukocyte F-actin binding protein)
• leukocyte-specific protein 1
• lymphocyte-specific protein 1
• lymphocyte-specific protein pp52
• pp52
• WP34Lymphocyte-specific antigen WP34

Background

LSP1 encodes an intracellular F-actin binding protein. The protein is expressed in lymphocytes, neutrophils, macrophages, and endothelium and may regulate neutrophil motility, adhesion to fibrinogen matrix proteins, and transendothelial migration. Alternative splicing results in multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LSP1 Antibody (NBP1-86852)(1)

Publication using NBP1-86852

• Johansson J, Tabor V, Wikell A et al. TGF--beta1-Induced Epithelial-Mesenchymal Transition Promotes Monocyte/Macrophage Properties in Breast Cancer Cells. Front Oncol 2015-01-01 [PMID: 25674539] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: LSP1