Recombinant Human LSD1 GST (N-Term) Protein

SDS-Page: Recombinant Human LSD1 Protein [H00023028-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Discontinued

Recombinant Human LSD1 GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence of (NP_055828) for Human LSD1
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: ADPWARGSYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRIADQFLGAMYTLPRQATPGVPAQQSPS

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: KDM1A
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
• Theoretical MW: 36.63 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LSD1 GST (N-Term) Protein

• amine oxidase (flavin containing) domain 2
• AOF2
• AOF2lysine-specific histone demethylase 1
• BHC110
• BHC110FAD-binding protein BRAF35-HDAC complex, 110 kDa subunit
• Flavin-containing amine oxidase domain-containing protein 2
• KIAA0601KDM1
• LSD1
• LSD1BRAF35-HDAC complex protein BHC110
• lysine (K)-specific demethylase 1
• Lysine (K)specific Demethylase 1A
• Lysine (K)-specific Demethylase 1A
• lysine-specific histone demethylase 1A

Background

LSD1 a recently identified, first known lysine-specific histone demethylase, is an 886 amino acid nuclear protein belonging to flavin monoamine oxidase family. It contains a SWIRM domain, a FAD-binding motif and an amine oxidase domain. This protein is ubiquitously expressed and is a component of several histone deacetylase complexes. LSD1 acts as a component of the CoREST and other transcriptional co-repressor complexes and also plays an important role in silencing neuronal-specific genes in non-neuronal cells. It is also known to demethylate Lys-4 of histone H3, a specific tag for epigenetic transcriptional activation. Reports suggest that it plays an important role in stimulating androgen-receptor-dependent transcription converting oxygen to hydrogen peroxide (might use alternative electron acceptors). Along with nuclear FHL2 it serves as a novel biomarker predictive for prostate cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: KDM1A