Recombinant Human LSD1 Protein

Images

 
SDS-Page: Recombinant Human LSD1 Protein [H00023028-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human LSD1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence of (NP_055828) for Human LSD1

Source: Wheat Germ

Amino Acid Sequence: ADPWARGSYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRIADQFLGAMYTLPRQATPGVPAQQSPS 753-851

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
KDM1A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LSD1 Protein

  • amine oxidase (flavin containing) domain 2
  • AOF2
  • AOF2lysine-specific histone demethylase 1
  • BHC110
  • BHC110FAD-binding protein BRAF35-HDAC complex, 110 kDa subunit
  • Flavin-containing amine oxidase domain-containing protein 2
  • KIAA0601KDM1
  • LSD1
  • LSD1BRAF35-HDAC complex protein BHC110
  • lysine (K)-specific demethylase 1
  • Lysine (K)specific Demethylase 1A
  • Lysine (K)-specific Demethylase 1A
  • lysine-specific histone demethylase 1A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB100-81657
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
MAB6047
Species: Hu
Applications: WB, ICC
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NB100-56664
Species: Hu, Mu
Applications: WB, ChIP, IHC-P
NB100-56519
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-FrFl
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NB110-40585
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IP
NBP1-90148
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-74510
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-182
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi, ICC
MAB2476
Species: Hu
Applications: WB, IHC
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP1-49600
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P
NBP2-67451
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
PP-H6506-00
Species: Hu
Applications: WB, IP, DirELISA
NBP1-92262
Species: Hu
Applications: IHC, IHC-P

Publications for LSD1 Recombinant Protein (H00023028-Q01) (0)

There are no publications for LSD1 Recombinant Protein (H00023028-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LSD1 Recombinant Protein (H00023028-Q01) (0)

There are no reviews for LSD1 Recombinant Protein (H00023028-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LSD1 Recombinant Protein (H00023028-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for LSD1 Recombinant Protein (H00023028-Q01)

Discover related pathways, diseases and genes to LSD1 Recombinant Protein (H00023028-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LSD1 Recombinant Protein (H00023028-Q01)

Discover more about diseases related to LSD1 Recombinant Protein (H00023028-Q01).
 

Pathways for LSD1 Recombinant Protein (H00023028-Q01)

View related products by pathway.

PTMs for LSD1 Recombinant Protein (H00023028-Q01)

Learn more about PTMs related to LSD1 Recombinant Protein (H00023028-Q01).
 

Research Areas for LSD1 Recombinant Protein (H00023028-Q01)

Find related products by research area.

Blogs on LSD1

There are no specific blogs for LSD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

FANCD2 Antibody
NB100-182

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LSD1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol KDM1A