LRRC4 Antibody

Staining of human cell line SH-SY5Y shows localization to the Golgi apparatus.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

LRRC4 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: APSGVSGEGAVVLPTIHDHINYNTYKPAHGAHWTENSLGNSLHPTVTTISEPYIIQTHTKDKVQE
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LRRC4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for LRRC4 Antibody

• BAG
• Brain Tumor Associated Protein LRRC4
• Brain Tumor-Associated Protein BAG
• Leucine Rich Repeat Containing 4
• Leucine-Rich Repeat-Containing 4
• Leucine-Rich Repeat-Containing Protein 4
• LRRC4
• NAG14
• Nasopharyngeal Carcinoma-Associated Gene 14 Protein
• Netrin-G2 Ligand
• NGL-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LRRC4
• Uniprot:
  • Q9HBW1()