LRRC35 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: LRRC35 Antibody [NBP1-89578] - Staining of human cell line U-2 OS shows positivity in nucleus, nucleoli and plasma membrane.
Immunohistochemistry-Paraffin: LRRC35 Antibody [NBP1-89578] - Staining of human testis shows strong cytoplasmic and nuclear positivity in cells of seminiferus ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LRRC35 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QPSGRSFMQVLCEKYSPENFPYRRGPGMGVHVPATPQGSPMKDRLNLPSVLVLNSCGITCAGDEKEIAAFCAHVSELDLSDNKLEDWHEVSKIVSNVP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TBCEL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LRRC35 Protein (NBP1-89578PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LRRC35 Antibody

  • tubulin-specific chaperone cofactor E-like protein
  • El
  • LRRC35
  • tubulin folding cofactor E-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24449
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow
NB400-118
Species: Hu, Mu(-)
Applications: WB, ELISA, ICC/IF
NBP2-53088
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-48002
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBL1-12547
Species: Hu
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
AF1436
Species: Mu
Applications: WB
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00054922-B01P
Species: Hu, Mu
Applications: WB, ELISA
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-46466
Species: Hu
Applications: IHC
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-88057
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for LRRC35 Antibody (NBP1-89578) (0)

There are no publications for LRRC35 Antibody (NBP1-89578).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRRC35 Antibody (NBP1-89578) (0)

There are no reviews for LRRC35 Antibody (NBP1-89578). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for LRRC35 Antibody (NBP1-89578) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LRRC35 Products

Bioinformatics Tool for LRRC35 Antibody (NBP1-89578)

Discover related pathways, diseases and genes to LRRC35 Antibody (NBP1-89578). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRRC35 Antibody (NBP1-89578)

Discover more about diseases related to LRRC35 Antibody (NBP1-89578).
 

Pathways for LRRC35 Antibody (NBP1-89578)

View related products by pathway.

Blogs on LRRC35

There are no specific blogs for LRRC35, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRRC35 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TBCEL