Tropomodulin 4 Antibody - BSA Free

Western Blot: Tropomodulin 4 Antibody [NBP1-80745] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: Tropomodulin 4 Antibody [NBP1-80745] - Staining in human skeletal muscle and heart muscle tissues using anti-TMOD4 antibody. Corresponding TMOD4 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Tropomodulin 4 Antibody [NBP1-80745] - Staining of human skeletal muscle shows cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: Tropomodulin 4 Antibody [NBP1-80745] - Staining of human heart muscle shows low expression as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Tropomodulin 4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Tropomodulin 4 Antibody - BSA Free (NBP1-80745) is a polyclonal antibody validated for use in IHC and WB. Anti-Tropomodulin 4 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MSNKQYYDALCSGEICNTEGISSVVQPDKYKPVPDEPPNPTNIEEILKRVRSNDKELEEVNL
• Predicted Species: Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TMOD4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Tropomodulin 4 Protein (NBP1-80745PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Tropomodulin 4 Antibody - BSA Free

• actin-capping protein
• DKFZp779I0852
• Skeletal muscle tropomodulin
• SK-TMOD
• tropomodulin 4 (muscle)
• tropomodulin-4

Background

Blocks the elongation and depolymerization of the actin filaments at the pointed end. The Tmod/TM complex contributes to the formation of the short actin protofilament, which in turn defines the geometry of the membrane skeleton

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Tropomodulin 4 Antibody (NBP1-80745)(1)

Publication using NBP1-80745

• Meister ML, Najjar RS, Danh JP et al. Berry consumption mitigates the hypertensive effects of a high-fat, high-sucrose diet via attenuation of renal and aortic AT1R expression resulting in improved endothelium-derived NO bioavailability The Journal of nutritional biochemistry 2022-11-23 [PMID: 36435288] (WB, Human, Mouse)

Bioinformatics

• Gene Symbol: TMOD4
• Entrez:
  • 29765(Human)