Myotrophin Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Myotrophin Antibody [NBP1-89787] - Staining of human cell line A-431 shows localization to plasma membrane & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Myotrophin Antibody [NBP1-89787] - Staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.

Immunohistochemistry-Paraffin: Myotrophin Antibody [NBP1-89787] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Myotrophin Antibody [NBP1-89787] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: Myotrophin Antibody [NBP1-89787] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-MTPN antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Myotrophin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Myotrophin Antibody - BSA Free (NBP1-89787) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MTPN
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockdown Validated
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Myotrophin Protein (NBP1-89787PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Myotrophin Antibody - BSA Free

• FLJ31098
• FLJ99857
• GCDP
• granule cell differentiation protein
• MYOTROPHIN
• Protein V-1
• V-1

Background

MTPN (Myotrophin) is a 118 amino acid protein that regulates NFkB activity by promiting dimerization of NFkB subunits. It also plays a role in regulating the growth of actin filaments. It promotes the growth of cardiomyocytes but not their proliferation and also promotes cardiac muscle hypertrophy. It inhibits F-actin-capping protein complex activity. Myotrophin may play a role in dilated cardiomyopathy, muscle hypertrophy, hypertension and cardiomyopathy.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MTPN