Myotrophin Antibody

Images

 
Western Blot: Myotrophin Antibody [NBP1-89787] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: Myotrophin Antibody [NBP1-89787] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: Myotrophin Antibody [NBP1-89787] - Staining of human tonsil shows strong positivity in cells outside the reaction centra while cells in the reaction centra were weaker stained.
Western Blot: Myotrophin Antibody [NBP1-89787] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-368

Product Details

Summary
Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Myotrophin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MTPN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Myotrophin Protein (NBP1-89787PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Myotrophin Antibody

  • FLJ31098
  • FLJ99857
  • GCDP
  • granule cell differentiation protein
  • MYOTROPHIN
  • Protein V-1
  • V-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-85731
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP2-12553
Species: Hu
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
H00028299-P01
Species: Hu
NBP1-84949
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NBP1-31386
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF245
Species: Hu
Applications: WB, Flow, CyTOF-ready

Publications for Myotrophin Antibody (NBP1-89787) (0)

There are no publications for Myotrophin Antibody (NBP1-89787).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Myotrophin Antibody (NBP1-89787) (0)

There are no reviews for Myotrophin Antibody (NBP1-89787). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Myotrophin Antibody (NBP1-89787) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Myotrophin Products

Bioinformatics Tool for Myotrophin Antibody (NBP1-89787)

Discover related pathways, diseases and genes to Myotrophin Antibody (NBP1-89787). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Myotrophin Antibody (NBP1-89787)

Discover more about diseases related to Myotrophin Antibody (NBP1-89787).
 

Pathways for Myotrophin Antibody (NBP1-89787)

View related products by pathway.

Research Areas for Myotrophin Antibody (NBP1-89787)

Find related products by research area.

Blogs on Myotrophin

There are no specific blogs for Myotrophin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Myotrophin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MTPN