LRPAP Antibody - BSA Free

Staining of human cell line SiHa shows localization to endoplasmic reticulum.

Analysis in human cell line RT-4.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LRPAP Antibody - BSA Free Summary

• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein LRPAP using the following amino acid sequence: ANLTDKELEAFREELKHFEAKIEKHNHYQKQLEIAHEKLRHAESVGDGERVSRSREKHALLEGRTKELGYTVKKHLQDLSGRISRARHNEL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LRPAP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
  • Western Blot 0.04-0.4 µg/ml
• Application Notes: For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for LRPAP Antibody - BSA Free

• A2MRAP
• A2MRAPMRAP
• A2RAP
• alpha-2-macroglobulin receptor-associated protein 1
• alpha-2-macroglobulin receptor-associated protein
• alpha-2-MRAP
• HBP44
• lipoprotein receptor associated protein
• low density lipoprotein receptor-related protein associated protein 1
• Low density lipoprotein receptor-related protein-associated protein 1
• low density lipoprotein-related protein-associated protein 1(alpha-2-macroglobulin receptor-associated protein 1)
• LRPAP
• LRPAP1
• MGC138272
• RAP

Background

Interacts with LRP1/alpha-2-macroglobulin receptor and glycoprotein 330

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LRPAP1