LRPAP Antibody


Western Blot: LRPAP Antibody [NBP1-69362] - This Anti-LRPAP1 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 2.5ug/ml.
Immunohistochemistry: LRPAP Antibody [NBP1-69362] - Human kidney.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

LRPAP Antibody Summary

Synthetic peptides corresponding to LRPAP1(low density lipoprotein receptor-related protein associated protein 1) The peptide sequence was selected from the C terminal of LRPAP1. Peptide sequence IDLWDLAQSANLTDKELEAFREELKHFEAKIEKHNHYQKQLEI
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Theoretical MW
39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for LRPAP Antibody

  • A2MRAP
  • A2RAP
  • alpha-2-macroglobulin receptor-associated protein 1
  • alpha-2-macroglobulin receptor-associated protein
  • Alpha-2-MRAP
  • HBP44
  • lipoprotein receptor associated protein
  • low density lipoprotein receptor-related protein associated protein 1
  • Low density lipoprotein receptor-related protein-associated protein 1
  • low density lipoprotein-related protein-associated protein 1(alpha-2-macroglobulin receptor-associated protein 1)
  • LRPAP1
  • MGC138272
  • RAP


LRPAP1 interacts with LRP1/alpha-2-macroglobulin receptor and glycoprotein 330.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb
Applications: IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, IHC
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
Species: Hu
Species: Hu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: PEP-ELISA
Species: Hu
Species: Hu, Pm
Applications: WB, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for LRPAP Antibody (NBP1-69362) (0)

There are no publications for LRPAP Antibody (NBP1-69362).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRPAP Antibody (NBP1-69362) (0)

There are no reviews for LRPAP Antibody (NBP1-69362). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LRPAP Antibody (NBP1-69362) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for LRPAP Antibody (NBP1-69362)

Discover related pathways, diseases and genes to LRPAP Antibody (NBP1-69362). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRPAP Antibody (NBP1-69362)

Discover more about diseases related to LRPAP Antibody (NBP1-69362).

Pathways for LRPAP Antibody (NBP1-69362)

View related products by pathway.

PTMs for LRPAP Antibody (NBP1-69362)

Learn more about PTMs related to LRPAP Antibody (NBP1-69362).

Blogs on LRPAP

There are no specific blogs for LRPAP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our LRPAP Antibody and receive a gift card or discount.


Gene Symbol LRPAP1