LRPAP Antibody

Images

 
Western Blot: LRPAP Antibody [NBP1-69362] - This Anti-LRPAP1 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 2.5ug/ml.
Immunohistochemistry: LRPAP Antibody [NBP1-69362] - Human kidney.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LRPAP Antibody Summary

Immunogen
Synthetic peptides corresponding to LRPAP1(low density lipoprotein receptor-related protein associated protein 1) The peptide sequence was selected from the C terminal of LRPAP1. Peptide sequence IDLWDLAQSANLTDKELEAFREELKHFEAKIEKHNHYQKQLEI
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LRPAP1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Theoretical MW
39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for LRPAP Antibody

  • A2MRAP
  • A2MRAPMRAP
  • A2RAP
  • alpha-2-macroglobulin receptor-associated protein 1
  • alpha-2-macroglobulin receptor-associated protein
  • alpha-2-MRAP
  • HBP44
  • lipoprotein receptor associated protein
  • low density lipoprotein receptor-related protein associated protein 1
  • Low density lipoprotein receptor-related protein-associated protein 1
  • low density lipoprotein-related protein-associated protein 1(alpha-2-macroglobulin receptor-associated protein 1)
  • LRPAP
  • LRPAP1
  • MGC138272
  • RAP

Background

LRPAP1 interacts with LRP1/alpha-2-macroglobulin receptor and glycoprotein 330.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52506
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-33560
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NLS6792
Species: Hu, Mu, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb
Applications: IHC-P
NBP2-22526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
H00010411-D01P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB110-96417
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-49938
Species: Hu, Mu
Applications: WB, IHC-P, IP
MAB6240
Species: Hu
Applications: WB, IHC
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
NB100-55268
Species: Hu
Applications: WB, IP
NBP1-87343
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-36999
Species: Hu, Mu, Rt
Applications: PEP-ELISA
NBP2-38621
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NBP1-69362
Species: Hu
Applications: WB, IHC, IHC-P

Publications for LRPAP Antibody (NBP1-69362) (0)

There are no publications for LRPAP Antibody (NBP1-69362).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRPAP Antibody (NBP1-69362) (0)

There are no reviews for LRPAP Antibody (NBP1-69362). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LRPAP Antibody (NBP1-69362) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LRPAP Products

Bioinformatics Tool for LRPAP Antibody (NBP1-69362)

Discover related pathways, diseases and genes to LRPAP Antibody (NBP1-69362). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRPAP Antibody (NBP1-69362)

Discover more about diseases related to LRPAP Antibody (NBP1-69362).
 

Pathways for LRPAP Antibody (NBP1-69362)

View related products by pathway.

PTMs for LRPAP Antibody (NBP1-69362)

Learn more about PTMs related to LRPAP Antibody (NBP1-69362).

Blogs on LRPAP

There are no specific blogs for LRPAP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRPAP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LRPAP1
Entrez
Uniprot