Home » LRH-1/NR5A2 » LRH-1/NR5A2 Proteins » Recombinant Human LRH-1/NR5A2 GST (N-Term) Protein

Recombinant Human LRH-1/NR5A2 GST (N-Term) Protein

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Recombinant Human LRH-1/NR5A2 Protein [H00002494-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Recombinant Human LRH-1/NR5A2 Protein [H00002494-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, Func, PA, AP

Order Details

100% Guarantee on every product

Recombinant Human LRH-1/NR5A2 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-495 of Human NR5A2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MSSNSDTGDLQESLKHGLTPIVSQFKMVNYSYDEDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRYTCIENQNCQIDKTQRKRCPYCRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRALKQQKKALIRANGLKLEAMSQVIQAMPSDLTISSAIQNIHSASKGLPLNHAALPPTDYDRSPFVTSPISMTMPPHGSLQGYQTYGHFPSRAIKSEYPDPYTSSPESIMGYSYMDSYQTSSPASIPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWARSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVVHGKEGSIFLVTGQQVDYSIIASQAGATLNNLMSHAQELVAKLRSLQFDQREFVCLKFLVLFSLDVKNLENFQLVEGVQEQVNAALLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHAKRA
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
NR5A2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
82.9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00002494-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LRH-1/NR5A2 GST (N-Term) Protein

  • Alpha-1-fetoprotein transcription factor
  • B1-binding factor
  • b1-binding factor, hepatocyte transcription factor which activates enhancer IIof hepatitis B virus
  • B1F
  • B1F2
  • fetoprotein-alpha 1 (AFP) transcription factor
  • FTFLRH1
  • FTZ-F1 beta
  • FTZ-F1
  • FTZ-F1beta
  • HB1F
  • hB1F-2
  • hB1FCYP7A promoter-binding factor
  • Hepatocytic transcription factor
  • Liver receptor homolog 1
  • liver receptor homolog-1
  • LRH1
  • LRH-1
  • LRH-1CPF
  • NR5A2
  • nuclear receptor NR5A2
  • nuclear receptor subfamily 5 group A member 2
  • nuclear receptor subfamily 5, group A, member 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...


SF-1/NR5A1/Steroidogen ...
NBP1-52823
Western Blot: SF-1/NR5A1/Steroidogenic Factor 1 Antibody [NBP1-52823] - Titration: 0.2-1 ug/ml, Positive Control: THP-1 cell lysate.
Immunohistochemistry-Paraffin: SF-1/NR5A1/Steroidogenic Factor 1 Antibody [NBP1-52823] - Human adrenal tissue at an antibody concentration of 4-8ug/ml.
(3 Publications)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
SHP/NR0B2/Nuclear
Receptor SHP Antibody
NLS5411
Immunohistochemistry-Paraffin: SHP/NR0B2/Nuclear Receptor SHP Antibody [NLS5411] - Breast, carcinoma
Immunohistochemistry-Paraffin: SHP/NR0B2/Nuclear Receptor SHP Antibody [NLS5411] - Analysis of anti-NR0B2 antibody with human liver, hepatocytes.
Immunohistochemistry-Paraffin: SHP/NR0B2/Nuclear Receptor SHP Antibody [NLS5411] - Pancreas, carcinoma
(2 Publications)
Species: Hu, Mu, Rt, Ha, Pm, Pm, Rb
Applications: ICC/IF, IHC, IHC-P
Aromatase Antibody
NB100-1596
Western Blot: Aromatase Antibody [NB100-1596] - Expression of the cytochrome P450 aromatase in the ovary of control (C; open bar; n = 6) and hypothyroid (Hypo; solid bar; n = 6) rabbits. Representative immunoblot showing the expression of aromatase. Image collected and cropped by CiteAb from the following publication (https://www.hindawi.com/journals/bmri/2017/3795950/), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Aromatase Antibody [NB100-1596] - U2OS cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-Aromatase Antibody NB100-1596 at 2 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
Immunohistochemistry-Paraffin: Aromatase Antibody [NB100-1596] - Expression of the cytochrome P450 aromatase in the ovary of control rabbits. Immunoreactivity of antiaromatase (+) was identified in granulosa cells of antral follicles (tertiary, tf; Graafian, gf) of control ovaries. Nonlabeling was observed when the primary antibody was omitted. Bars: 200 um (1st image) and 20 um (2nd image). Granulose cells, gc; theca cells, tc. Image collected and cropped by CiteAb from the following publication (https://www.hindawi.com/journals/bmri/2017/3795950/), licensed under a CC-BY licence.
(8 Publications)
Species: Hu, Rt, Pm, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
FXR/NR1H4 Antibody
NB400-153
Western Blot: FXR/NR1H4 Antibody [NB400-153] - Total protein from human A549, U2OS cell and mouse 3T3 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-FXR (NB400-153) in block buffer and detected with an anti-rabbit HRP secondary antibody using NovaLume chemiluminescence detection reagent (NPB2-61915).
Immunocytochemistry/Immunofluorescence: FXR/NR1H4 Antibody [NB400-153] - A549 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-FXR/NR1H4 at 2 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse Dylight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Western Blot: FXR Antibody [NB400-153] - Detection of FXR in HeLa nuclear extract using NB400-153. ECL 30 minute detection.
(3 Reviews)
(3 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF
CYP7A1 Antibody
(946902) [Unconjugate
MAB9120
CYP7A1 was detected in immersion fixed human hepatocytes induced with dexamethasone for 48 hours using Mouse Anti-Human CYP7A1 Polyclonal Antibody (Catalog # MAB9120) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (green). Specific staining was localized to endoplasmic reticula and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Species: Hu
Applications: ICC
DAX1/NR0B1
Antibody (H7431)
PP-H7431-00
DAX1/NR0B1 Antibody (H7431)
(2 Publications)
Species: Hu
Applications: WB

Acetylcholinesterase/A
NB100-1519
Western Blot: Acetylcholinesterase/ACHE Antibody [NB100-1519] - Staining of HepG2 (A) and Daudi cell lysates with antibody at 1 ug/mL (B) and HeLa (C) and Jurkat (D) cell lysates with antibody at 0.3 ug/mL (35 ug protein in RIPA buffer). Detected by chemiluminescence.
Immunocytochemistry/Immunofluorescence: Acetylcholinesterase/ACHE Antibody [NB100-1519] - Immunofluorescence analysis of paraformaldehyde fixed U2OS cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (4 ug/mL), showing cytoplasmic and nuclear/Vesicle staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (4 ug/mL).
Flow Cytometry: Acetylcholinesterase/ACHE Antibody [NB100-1519] - Flow cytometric analysis of paraformaldehyde fixed HeLa cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, PEP-ELISA, IHC-FrFl

Butyrylcholinesterase/ ...
AF9024
Western blot shows lysates of mouse heart tissue and mouse liver tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Mouse/Rat Butyrylcholinesterase/BCHE Polyclonal Antibody (Catalog # AF9024) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Butyrylcholinesterase/BCHE at approximately 75 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Butyrylcholinesterase/BCHE was detected in perfusion fixed frozen sections of mouse brain using Goat Anti-Mouse/Rat Butyrylcholinesterase/BCHE Antigen Affinity-purified Polyclonal Antibody (Catalog # AF9024) at 5 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit  (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to glial cells. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Species: Mu, Rt
Applications: WB, IHC
OCT4 Antibody
NB100-2379
Western Blot: OCT4 Antibody [NB100-2379] - YM155 significantly reduced tumorsphere formation and inhibited EGFR autophosphorylation and G9a expression. YM155 is reported to suppress cancer stemness; therefore, we used this compound to investigate the cellular mechanism of tumorsphere formation. To compare the cytotoxic capacity of YM155 against tumorsphere formation and parental cell lines, YM155 was applied to HCC827 and A549 cells in the stemness cultured or integrated medium. (F) Moreover, YM155 inhibited EGFR autophosphorylation in A549-derived tumorspheres and reduced Oct4 expression. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0182149) licensed under a CC-BY licence.
Western Blot: OCT4 Antibody [NB100-2379] - WB detection of OCT4 in mouse brain lysate using OCT4 antibody with ECL based detection. The antibody generated a specific band of OCT4 at the expected ~40kDa position.
Flow Cytometry: OCT4 Antibody [NB100-2379] - An intracellular stain was performed on Jurkat with NB100-2379 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody.
(2 Reviews)
(17 Publications)
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC
HNF-4 alpha/NR2A1
Antibody
NBP1-89679
Western Blot: HNF-4 alpha/NR2A1 Antibody [NBP1-89679] - Analysis in human cell lines Caco-2 and PC-3 using anti-HNF4A antibody. Corresponding HNF4A RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
Immunocytochemistry/Immunofluorescence: HNF-4 alpha/NR2A1 Antibody [NBP1-89679] - Staining of human cell line CACO-2 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Frozen: HNF-4 alpha/NR2A1 Antibody [NBP1-89679] - Frozen 8 um rat liver tissue section fixed in formalin. HNF-4 alpha antibody at 1:100 (green). Multiplexed with a myeloperoxidase antibody (red). DAPI staining in blue. IHC-Fr image submitted by a verified customer review.
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
SRC1 Antibody
(1135)
NB200-310
Western Blot: SRC1 Antibody (1135/H4) [NB200-310] - Mouse tissue (50 ug) was separated by 5% SDS-PAGE, and the membrane was blotted with SRC1 antibody [1135] diluted at 1:2000.
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, IP
ER alpha/NR3A1
Antibody (33)
NB300-560
Western Blot: ER alpha/NR3A1 Antibody (33) [NB300-560] - Analysis of recombinant ER alpha.
Immunohistochemistry-Paraffin: ER alpha/NR3A1 Antibody (33) [NB300-560] - Human breast tissue (B) and magnified section (C) compared with an isotype control (A).
Immunohistochemistry-Frozen: ER alpha/NR3A1 Antibody (33) [NB300-560] - Human breast carcinoma (B) and magnified section (C) compared with an isotype control (A).
(1 Review)
(7 Publications)
Species: Hu, Mu, Rt, Av, Bv, Ma, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(33 Reviews)
(647 Publications)
Species: Hu
CYP8B1 Antibody
NBP1-68884
Western Blot: CYP8B1 Antibody [NBP1-68884] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
Species: Hu
Applications: WB
PPAR gamma/NR1C3
Antibody
NBP2-22106
Western Blot: PPAR gamma/NR1C3 Antibody [NBP2-22106] - Total protein from 3T3-L1 mouse embryonic fibroblast adipose-like cell line, separated by 4-12% SDS-PAGE, transferred to nitrocellulose membrane and blocked in 5% non-fat milk for 1h at room temperature. The membrane was probed with anti-PPAR gamma 1:800 in non-fat milk. Lane 2-7 increasing protein concentration, undifferentiated adipocytes. Lane 8-13 increasing protein concentration, differentiated adipocytes. This image was submitted via customer review.
Immunohistochemistry-Paraffin: PPAR gamma Antibody [NBP2-22106] - IHC analysis of PPAR gamma in mouse liver.
Western Blot: PPAR gamma Antibody [NBP2-22106] - Western blot analysis of PPAR gamma in 1. human adipose and 2. human adrenal lysate.
(2 Reviews)
(5 Publications)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
CYP11A1 Antibody
NBP1-85368
Western Blot: CYP11A1 Antibody [NBP1-85368] - protein extract from: 1) human liver (negative), 2) human testis (positve), 3) MW marker (drawn with special ECL reagent marker), 4) human testis, 5) H295R adrenal cell line. Image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: CYP11A1 Antibody [NBP1-85368] - CYP11A1 expression (Leydig cells) present in early pubertal Rhesus monkey. Secondary antibody: Alexa Fluor488 anti rabbit. Image submitted by a verified customer review.
Immunohistochemistry-Paraffin: CYP11A1 Antibody [NBP1-85368] - Staining of human cerebral cortex shows low expression as expected.
(4 Reviews)
(1 Publication)
Species: Hu, RM
Applications: WB, ICC/IF, IHC, IHC-P
CYP11B1 Antibody
NBP1-68883
Western Blot: CYP11B1 Antibody [NBP1-68883] - Titration: 0.2-1 ug/ml, Positive Control: Human Liver.
Immunohistochemistry: CYP11B1 Antibody [NBP1-68883] - Monkey vagina Primary Antibody Dilution: 1 : 25 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1 : 1000 Color/Signal Descriptions: Brown: CYP11B1 Blue: Nucleus Gene name: CYP11B1 Submitted by: Jonathan Bertin, Endoceutics Inc.
Immunohistochemistry: CYP11B1 Antibody [NBP1-68883] - Monkey adrenal gland Primary Antibody Dilution: 1 : 25 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1 : 1000 Color/Signal Descriptions: Brown: CYP11B1 Blue: Nucleus Gene name: CYP11B1 Submitted by: Jonathan Bertin, Endoceutics Inc.
Species: Hu, Pm
Applications: WB, IHC, IHC-P
BRD2 Antibody
NBP1-30475
Western Blot: BRD2 Antibody [NBP1-30475] - Detection of Human and Mouse BRD2 by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa, 293T, and mouse NIH3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-BRD2 antibody NBP1-30475 used for WB at 0.04 ug/mL. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunocytochemistry/Immunofluorescence: BRD2 Antibody [NBP1-30475] - Formaldehyde-fixed asynchronous HeLa cells. Antibody: Affinity purified rabbit anti- BRD2 used at a dilution of 1:100 (2 ug/mL) (left) and rabbit anti-BRD2 recombinant monoclonal used at a dilution of 1:20 (right). Detection: Red-fluorescent goat anti-rabbit IgG cross-adsorbed Antibody DyLight 594 conjugated.
Immunohistochemistry-Paraffin: BRD2 Antibody [NBP1-30475] - Section of human ovarian carcinoma. Antibody: Affinity purified rabbit anti-BRD2 (NBP1-30475). Detection: DAB
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for LRH-1/NR5A2 Recombinant Protein (H00002494-P01)(1)


Reviews for LRH-1/NR5A2 Recombinant Protein (H00002494-P01) (0)

There are no reviews for LRH-1/NR5A2 Recombinant Protein (H00002494-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LRH-1/NR5A2 Recombinant Protein (H00002494-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Learn about Custom Antibody Labeling

Additional LRH-1/NR5A2 Products

Bioinformatics Tool for LRH-1/NR5A2 Recombinant Protein (H00002494-P01)

Discover related pathways, diseases and genes to LRH-1/NR5A2 Recombinant Protein (H00002494-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRH-1/NR5A2 Recombinant Protein (H00002494-P01)

Discover more about diseases related to LRH-1/NR5A2 Recombinant Protein (H00002494-P01).
 

Pathways for LRH-1/NR5A2 Recombinant Protein (H00002494-P01)

View related products by pathway.

PTMs for LRH-1/NR5A2 Recombinant Protein (H00002494-P01)

Learn more about PTMs related to LRH-1/NR5A2 Recombinant Protein (H00002494-P01).
 

Research Areas for LRH-1/NR5A2 Recombinant Protein (H00002494-P01)

Find related products by research area.

Blogs on LRH-1/NR5A2

There are no specific blogs for LRH-1/NR5A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Western Blot: OCT4 Antibody [NB100-2379] - YM155 significantly reduced tumorsphere formation and inhibited EGFR autophosphorylation and G9a expression. YM155 is reported to suppress cancer stemness; therefore, we used this compound to investigate the cellular mechanism of tumorsphere formation. To compare the cytotoxic capacity of YM155 against tumorsphere formation and parental cell lines, YM155 was applied to HCC827 and A549 cells in the stemness cultured or integrated medium. (F) Moreover, YM155 inhibited EGFR autophosphorylation in A549-derived tumorspheres and reduced Oct4 expression. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0182149) licensed under a CC-BY licence.
OCT4 Antibody
NB100-2379

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LRH-1/NR5A2 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol NR5A2