Recombinant Human LRH-1/NR5A2 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human LRH-1/NR5A2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-495 of Human NR5A2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSSNSDTGDLQESLKHGLTPIVSQFKMVNYSYDEDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRYTCIENQNCQIDKTQRKRCPYCRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRALKQQKKALIRANGLKLEAMSQVIQAMPSDLTISSAIQNIHSASKGLPLNHAALPPTDYDRSPFVTSPISMTMPPHGSLQGYQTYGHFPSRAIKSEYPDPYTSSPESIMGYSYMDSYQTSSPASIPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWARSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVVHGKEGSIFLVTGQQVDYSIIASQAGATLNNLMSHAQELVAKLRSLQFDQREFVCLKFLVLFSLDVKNLENFQLVEGVQEQVNAALLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHAKRA

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
NR5A2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
82.9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00002494-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LRH-1/NR5A2 Protein

  • Alpha-1-fetoprotein transcription factor
  • B1-binding factor
  • b1-binding factor, hepatocyte transcription factor which activates enhancer IIof hepatitis B virus
  • B1F
  • B1F2
  • fetoprotein-alpha 1 (AFP) transcription factor
  • FTFLRH1
  • FTZ-F1 beta
  • FTZ-F1
  • FTZ-F1beta
  • HB1F
  • hB1F-2
  • hB1FCYP7A promoter-binding factor
  • Hepatocytic transcription factor
  • Liver receptor homolog 1
  • liver receptor homolog-1
  • LRH1
  • LRH-1
  • LRH-1CPF
  • NR5A2
  • nuclear receptor NR5A2
  • nuclear receptor subfamily 5 group A member 2
  • nuclear receptor subfamily 5, group A, member 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP2-46522
Species: Hu
Applications: WB, IHC
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
PP-A9033A-00
Species: Hu
Applications: WB, IHC, IP, DirELISA
MAB9120
Species: Hu
Applications: ICC
PP-H7431-00
Species: Hu
Applications: WB
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NBP2-03523
Species: Hu, Ca
Applications: WB, Flow
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP1-89679
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-29939
Species: Hu
Applications: WB, Flow, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-54758
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-68883
Species: Hu, Mu, Mk
Applications: WB, IHC
NBP1-84310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for LRH-1/NR5A2 Recombinant Protein (H00002494-P01)(1)

Reviews for LRH-1/NR5A2 Recombinant Protein (H00002494-P01) (0)

There are no reviews for LRH-1/NR5A2 Recombinant Protein (H00002494-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LRH-1/NR5A2 Recombinant Protein (H00002494-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for LRH-1/NR5A2 Recombinant Protein (H00002494-P01)

Discover related pathways, diseases and genes to LRH-1/NR5A2 Recombinant Protein (H00002494-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRH-1/NR5A2 Recombinant Protein (H00002494-P01)

Discover more about diseases related to LRH-1/NR5A2 Recombinant Protein (H00002494-P01).
 

Pathways for LRH-1/NR5A2 Recombinant Protein (H00002494-P01)

View related products by pathway.

PTMs for LRH-1/NR5A2 Recombinant Protein (H00002494-P01)

Learn more about PTMs related to LRH-1/NR5A2 Recombinant Protein (H00002494-P01).
 

Research Areas for LRH-1/NR5A2 Recombinant Protein (H00002494-P01)

Find related products by research area.

Blogs on LRH-1/NR5A2

There are no specific blogs for LRH-1/NR5A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

OCT4 Antibody
NB100-2379

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LRH-1/NR5A2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NR5A2
Entrez