Home » LRH-1/NR5A2 » LRH-1/NR5A2 Proteins » Recombinant Human LRH-1/NR5A2 Protein

Recombinant Human LRH-1/NR5A2 Protein

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

100% Guarantee on every product

Recombinant Human LRH-1/NR5A2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-495 of Human NR5A2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSSNSDTGDLQESLKHGLTPIVSQFKMVNYSYDEDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRYTCIENQNCQIDKTQRKRCPYCRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRALKQQKKALIRANGLKLEAMSQVIQAMPSDLTISSAIQNIHSASKGLPLNHAALPPTDYDRSPFVTSPISMTMPPHGSLQGYQTYGHFPSRAIKSEYPDPYTSSPESIMGYSYMDSYQTSSPASIPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWARSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVVHGKEGSIFLVTGQQVDYSIIASQAGATLNNLMSHAQELVAKLRSLQFDQREFVCLKFLVLFSLDVKNLENFQLVEGVQEQVNAALLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHAKRA
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
NR5A2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
82.9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00002494-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LRH-1/NR5A2 Protein

  • Alpha-1-fetoprotein transcription factor
  • B1-binding factor
  • b1-binding factor, hepatocyte transcription factor which activates enhancer IIof hepatitis B virus
  • B1F
  • B1F2
  • fetoprotein-alpha 1 (AFP) transcription factor
  • FTFLRH1
  • FTZ-F1 beta
  • FTZ-F1
  • FTZ-F1beta
  • HB1F
  • hB1F-2
  • hB1FCYP7A promoter-binding factor
  • Hepatocytic transcription factor
  • Liver receptor homolog 1
  • liver receptor homolog-1
  • LRH1
  • LRH-1
  • LRH-1CPF
  • NR5A2
  • nuclear receptor NR5A2
  • nuclear receptor subfamily 5 group A member 2
  • nuclear receptor subfamily 5, group A, member 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...


SF-1/NR5A1/Steroidogen ...
PP-N1665-00
SF-1/NR5A1/Steroidogenic Factor 1 Antibody (N1665)
(2 Reviews)
(1 Publication)
Species: Hu
Applications: WB, IHC, IP
SHP/NR0B2/Nuclear
Receptor SHP Antibody ...
NBP2-46522
Western Blot: SHP/NR0B2/Nuclear Receptor SHP Antibody (7B5) [NBP2-46522] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY NR0B2.
Immunohistochemistry: SHP/NR0B2/Nuclear Receptor SHP Antibody (7B5) [NBP2-46522] - Analysis of Human tonsil tissue. (Heat-induced epitope retrieval by Tris-EDTA, pH8.0)
Immunohistochemistry: SHP/NR0B2/Nuclear Receptor SHP Antibody (7B5) [NBP2-46522] - Analysis of Adenocarcinoma of Human breast tissue. (Heat-induced epitope retrieval by Tris-EDTA, pH8.0).
Species: Hu
Applications: WB, IHC
Aromatase Antibody
NB100-1596
Western Blot: Aromatase Antibody [NB100-1596] - Detection of aromatase in human fetal temporal lobe lysate using NB 100-1596. ECL exposure, 1-2 minutes.
Immunocytochemistry/Immunofluorescence: Aromatase Antibody [NB100-1596] - Aromatase antibody was tested in SH-SY-5Y cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
(5 Publications)
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
FXR/NR1H4 Antibody
(A9033A) [Unconjugate ...
PP-A9033A-00
FXR/NR1H4 Antibody (A9033A) [Unconjugated]
(2 Reviews)
(5 Publications)
Species: Hu
Applications: WB, IHC, IP, DirELISA
CYP7A1 Antibody
(946902) [Unconjugate
MAB9120
CYP7A1 was detected in immersion fixed human hepatocytes induced with dexamethasone for 48 hours using Mouse Anti-Human CYP7A1 Polyclonal Antibody (Catalog # MAB9120) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (green). Specific staining was localized to endoplasmic reticula and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Species: Hu
Applications: ICC
DAX1/NR0B1
Antibody (H7431)
PP-H7431-00
DAX1/NR0B1 Antibody (H7431)
(2 Publications)
Species: Hu
Applications: WB

Acetylcholinesterase/A ...
NBP2-22449
Western Blot: Acetylcholinesterase/ACHE Antibody (ZR3) [NBP2-22449] - Western blot analysis was performed on whole cell extracts (30 ug lysate) of Mouse Brain (lane 1), HeLa (lane 2), SK-N-SH (lane 3) and U-87 MG (lane 4).
Immunocytochemistry/Immunofluorescence: Acetylcholinesterase/ACHE Antibody (ZR3) [NBP2-22449] - Analysis of Acetylcholinesterase using Acetylcholinesterase Monoclonal antibody (ZR3) shows staining in U251 glioma cells. Acetylcholinesterase staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Acetylcholinesterase at a dilution of 1:20 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Flow Cytometry: Acetylcholinesterase/ACHE Antibody (ZR3) [NBP2-22449] - Acetylcholinesterase/ACHE Antibody (ZR3) [NBP2-22449] - Flow cytometry analysis of Acetyl cholinesterase was done on U-87 MG cells. Cells were fixed with 70% ethanol for 10 minutes, permeabilized with 0.25% Triton™ X-100 for 20 minutes, and blocked with 5% BSA for 30 minutes at room temperature. Cells were labeled with Acetyl cholinesterase Mouse Monoclonal Antibody (red histogram) or with mouse isotype control (yellow histogram) at 3-5 ug/million cells in 2.5% BSA.
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS

Butyrylcholinesterase/ ...
NBP2-03523
Western Blot: Butyrylcholinesterase Antibody (1E1) [NBP2-03523] Analysis of extracts (35ug) from 9 different cell lines by using anti-Butyrylcholinesterase monoclonal antibody (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).
Flow Cytometry: Butyrylcholinesterase Antibody (1E1) [NBP2-03523] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Butyrylcholinesterase antibody, and then analyzed by flow cytometry.
Western Blot: Butyrylcholinesterase Antibody (1E1) [NBP2-03523] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Butyrylcholinesterase (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Butyrylcholinesterase.
Species: Hu, Ca
Applications: WB, Flow
OCT4 Antibody
NB100-2379
Western Blot: OCT4 Antibody [NB100-2379] - WB detection of OCT4 in mouse brain lysate using OCT4 antibody with ECL based detection. The antibody generated a specific band of OCT4 at the expected ~40kDa position.
Immunocytochemistry/Immunofluorescence: OCT4 Antibody [NB100-2379] - OCT4 staining in NTERA-2 cells detected with a Dylight 488 labeled secondary antibody.
Flow Cytometry: OCT4 Antibody [NB100-2379] - An intracellular stain was performed on Jurkat with OCT4 Antibody NB100-2379 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 550 (SA5-10033, Thermo Fisher).
(8 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
HNF-4 alpha/NR2A1
Antibody
NBP1-89679
Western Blot: HNF-4 alpha/NR2A1 Antibody [NBP1-89679] - Analysis in human cell lines Caco-2 and PC-3 using anti-HNF4A antibody. Corresponding HNF4A RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
Immunocytochemistry/Immunofluorescence: HNF-4 alpha/NR2A1 Antibody [NBP1-89679] - Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: HNF-4 alpha/NR2A1 Antibody [NBP1-89679] - Staining in human duodenum and tonsil tissues using anti-HNF4A antibody. Corresponding HNF4A RNA-seq data are presented for the same tissues.
(4 Publications)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
SRC1 Antibody
(1135)
NB200-310
Western Blot: SRC1 Antibody (1135/H4) [NB200-310] - Mouse tissue (50 ug) was separated by 5% SDS-PAGE, and the membrane was blotted with SRC1 antibody [1135] diluted at 1:2000.
Western Blot: SRC1 Antibody (1135/H4) [NB200-310] - Sample (50 ug of whole cell lysate) A: Mouse brain 5% SDS PAGE, antibody diluted at 1:2000.
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
ER alpha/NR3A1
Antibody (EVG F9)
NB100-74413
Western Blot: ER alpha/NR3A1 Antibody (EVG F9) [NB100-74413] - Analysis of various whole cell lysates.
Immunocytochemistry/Immunofluorescence: ER alpha/NR3A1 Antibody (EVG F9) [NB100-74413] - Analysis of Estrogen Receptor alpha using Anti-Estrogen Receptor alpha Monoclonal Antibody (EVG F9) shows staining in U251 Cells. Estrogen Receptor alpha staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Estrogen Receptor alpha at a dilution of 1:200 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Immunohistochemistry-Paraffin: ER alpha/NR3A1 Antibody (EVG F9) [NB100-74413] - Cancer biopsies of deparaffinized Human breast carcinoma tissues.
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
TNF-alpha
[Unconjugated]
210-TA
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(19 Reviews)
(506 Publications)
Species: Hu
CYP8B1 Antibody
NBP2-29939
Western Blot: CYP8B1 Antibody [NBP2-29939] - Western blot analysis of (C-term) (NBP2-29939 ) in K562 cell line lysates (35ug/lane). CYP8B1 (arrow) was detected using the purified Pab.
Immunohistochemistry-Paraffin: CYP8B1 Antibody [NBP2-29939] - Formalin-fixed and paraffin-embedded human hepatocarcinoma reacted with (C-term), which was peroxidase-conjugated to the secondary antibody, followed by DAB staining. This data demonstrates the use of this antibody for immunohistochemistry; clinical relevance has not been evaluated.
Flow Cytometry: CYP8B1 Antibody [NBP2-29939] - Flow cytometric analysis of k562 cells (bottom histogram) compared to a negative control cell (top histogram).FITC-conjugated goat-anti-rabbit secondary antibodies were used for the analysis.
Species: Hu
Applications: WB, Flow, IHC-P
PPAR gamma/NR1C3
Antibody
NBP2-22106
Western Blot: PPAR gamma/NR1C3 Antibody [NBP2-22106] - Total protein from 3T3-L1 mouse embryonic fibroblast adipose-like cell line, separated by 4-12% SDS-PAGE, transferred to nitrocellulose membrane and blocked in 5% non-fat milk for 1h at room temperature. The membrane was probed with anti-PPAR gamma 1:800 in non-fat milk. Lane 2-7 increasing protein concentration, undifferentiated adipocytes. Lane 8-13 increasing protein concentration, differentiated adipocytes. This image was submitted via customer review.
Immunohistochemistry-Paraffin: PPAR gamma Antibody [NBP2-22106] - IHC analysis of PPAR gamma in mouse liver.
Western Blot: PPAR gamma Antibody [NBP2-22106] - Western blot analysis of PPAR gamma in 1. human adipose and 2. human adrenal lysate.
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
CYP11A1 Antibody
NBP1-54758
Western Blot: CYP11A1 Antibody [NBP1-54758] - Sample Type: Hela Antibody Dilution: 1.0 ug/ml CYP11A1 is supported by BioGPS gene expression data to be expressed in HeLa
Immunohistochemistry: CYP11A1 Antibody [NBP1-54758] - Human Placenta lysate tissue at an antibody concentration of 5.0 ug/ml using anti-CYP11A1 antibody
Western Blot: CYP11A1 Antibody [NBP1-54758] - CYP11A1 antibody - middle region validated by WB using Hela cell lysate at 1ug/ml.
Species: Hu
Applications: WB, IHC, IHC-P
CYP11B1 Antibody
NBP1-68883
Western Blot: CYP11B1 Antibody [NBP1-68883] - 1. HEK293TN-GFP-hcyp11B1 (75ug) 2. HEK293TN-GFP-hcyp11B2 (75ug) Primary dilution: 1 : 100 Secondary Antibody: mouse anti-Rabbit HRP Secondary Dilution: 1 : 10,000Film Exposed for: 5 minutesImage Submitted by: Celso Gomez-SanchezMongomery VA Medical Center.
Immunohistochemistry: CYP11B1 Antibody [NBP1-68883] - Monkey vagina Primary Antibody Dilution: 1 : 25 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1 : 1000 Color/Signal Descriptions: Brown: CYP11B1 Blue: Nucleus Gene name: CYP11B1 Submitted by: Jonathan Bertin, Endoceutics Inc.
Western Blot: CYP11B1 Antibody [NBP1-68883] - Sample type: 1. HEK293TN-GFP-hcyp11B1 (75ug) 2. HEK293TN-GFP-hcyp11B2 (75ug) Primary Dilution: 1:100 Secondary Antibody: mouse anti-Rabbit HRP Secondary Dilution: 1:10,000 Film Exposed for: 5 minutes
Species: Hu, Mu, Mk
Applications: WB, IHC
BRD2 Antibody
NBP1-84310
Western Blot: BRD2 Antibody [NBP1-84310] - Analysis in human cell lines HEK293 and MCF-7 using Anti-BRD2 antibody. Corresponding BRD2 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Immunocytochemistry/Immunofluorescence: BRD2 Antibody [NBP1-84310] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: BRD2 Antibody [NBP1-84310] - Staining in human testis and liver tissues. Corresponding BRD2 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for LRH-1/NR5A2 Recombinant Protein (H00002494-P01)(1)


Reviews for LRH-1/NR5A2 Recombinant Protein (H00002494-P01) (0)

There are no reviews for LRH-1/NR5A2 Recombinant Protein (H00002494-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LRH-1/NR5A2 Recombinant Protein (H00002494-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for LRH-1/NR5A2 Recombinant Protein (H00002494-P01)

Discover related pathways, diseases and genes to LRH-1/NR5A2 Recombinant Protein (H00002494-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRH-1/NR5A2 Recombinant Protein (H00002494-P01)

Discover more about diseases related to LRH-1/NR5A2 Recombinant Protein (H00002494-P01).
 

Pathways for LRH-1/NR5A2 Recombinant Protein (H00002494-P01)

View related products by pathway.

PTMs for LRH-1/NR5A2 Recombinant Protein (H00002494-P01)

Learn more about PTMs related to LRH-1/NR5A2 Recombinant Protein (H00002494-P01).
 

Research Areas for LRH-1/NR5A2 Recombinant Protein (H00002494-P01)

Find related products by research area.

Blogs on LRH-1/NR5A2

There are no specific blogs for LRH-1/NR5A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

12.5% SDS-PAGE Stained with Coomassie Blue.
Recombinant Human LRH-1/NR5A2 Protein
H00002494-Q01-10ug
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
TNF-alpha [Unconjugated]
210-TA-005
Western Blot: LRH-1/NR5A2 Antibody [NBP2-27196] - Analysis of NR5A2 in HEPG2 lysate in the 1) absence and 2) presence of immunizing peptide, 3) mouse NIH3T3 and 4) RAW lysate probed with 3 ug/ml of NR5A2 antibody. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
LRH-1/NR5A2 Antibody
NBP2-27196
Western Blot: OCT4 Antibody [NB100-2379] - WB detection of OCT4 in mouse brain lysate using OCT4 antibody with ECL based detection. The antibody generated a specific band of OCT4 at the expected ~40kDa position.
OCT4 Antibody
NB100-2379

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LRH-1/NR5A2 Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol NR5A2
Entrez