Recombinant Human LRH-1/NR5A2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human LRH-1/NR5A2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-110 of Human NR5A2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:AQELVAKLRSLQFDQREFVCLKFLVLFSLDVKNLENFQLVEGVQEQVNAALLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHAKR

Protein/Peptide Type
Partial Recombinant Protein
Gene
NR5A2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LRH-1/NR5A2 Protein

  • Alpha-1-fetoprotein transcription factor
  • B1-binding factor
  • b1-binding factor, hepatocyte transcription factor which activates enhancer IIof hepatitis B virus
  • B1F
  • B1F2
  • fetoprotein-alpha 1 (AFP) transcription factor
  • FTFLRH1
  • FTZ-F1 beta
  • FTZ-F1
  • FTZ-F1beta
  • HB1F
  • hB1F-2
  • hB1FCYP7A promoter-binding factor
  • Hepatocytic transcription factor
  • Liver receptor homolog 1
  • liver receptor homolog-1
  • LRH1
  • LRH-1
  • LRH-1CPF
  • NR5A2
  • nuclear receptor NR5A2
  • nuclear receptor subfamily 5 group A member 2
  • nuclear receptor subfamily 5, group A, member 2

Background

NR5A2 - nuclear receptor subfamily 5, group A, member 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP2-46522
Species: Hu
Applications: WB, IHC
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
NB400-153
Species: Hu
Applications: WB, ICC/IF
MAB9120
Species: Hu
Applications: ICC
PP-H7431-00
Species: Hu
Applications: WB
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
AF9024
Species: Mu, Rt
Applications: WB, IHC
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-50218
Species: Hu, Rt
Applications: WB, ELISA, IHC
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-54758
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-68883
Species: Hu, Mu, Mk
Applications: WB, IHC
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA

Publications for LRH-1/NR5A2 Partial Recombinant Protein (H00002494-Q01) (0)

There are no publications for LRH-1/NR5A2 Partial Recombinant Protein (H00002494-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRH-1/NR5A2 Partial Recombinant Protein (H00002494-Q01) (0)

There are no reviews for LRH-1/NR5A2 Partial Recombinant Protein (H00002494-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LRH-1/NR5A2 Partial Recombinant Protein (H00002494-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LRH-1/NR5A2 Products

Bioinformatics Tool for LRH-1/NR5A2 Partial Recombinant Protein (H00002494-Q01)

Discover related pathways, diseases and genes to LRH-1/NR5A2 Partial Recombinant Protein (H00002494-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRH-1/NR5A2 Partial Recombinant Protein (H00002494-Q01)

Discover more about diseases related to LRH-1/NR5A2 Partial Recombinant Protein (H00002494-Q01).
 

Pathways for LRH-1/NR5A2 Partial Recombinant Protein (H00002494-Q01)

View related products by pathway.

PTMs for LRH-1/NR5A2 Partial Recombinant Protein (H00002494-Q01)

Learn more about PTMs related to LRH-1/NR5A2 Partial Recombinant Protein (H00002494-Q01).
 

Research Areas for LRH-1/NR5A2 Partial Recombinant Protein (H00002494-Q01)

Find related products by research area.

Blogs on LRH-1/NR5A2

There are no specific blogs for LRH-1/NR5A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

OCT4 Antibody
NB100-2379

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LRH-1/NR5A2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NR5A2
Entrez